KEGG   Auricularia subglabra: AURDEDRAFT_113048Help
Entry
AURDEDRAFT_113048 CDS       T03129                                 

Definition
(GenBank) heme peroxidase
Organism
adl  Auricularia subglabra
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-ProteinID: EJD48184
JGI: 113048
LinkDB All DBs
AA seq 1166 aa AA seqDB search
MFSTLTRAAASAYDAAAQVANLAVLAQRPILDDGKHDTHTAGLRALESIKSQFKLGLPLL
PSAANVDAIMDALAHADSGIDDRKWLLEEVLMILAKLPRGSWLSTVLENRIVELFYRDLP
HPPSTFLGRPPLLPSYLASSVSSPNVSPQNSILIGKSYSNGNGSGSWSNGNGSGVLSGMP
NGYALGSNDPAATAYPPPDVFSGKPYAHRMPDGSNNNPLFPDLGRAGMPYARTVPPSNPV
PQSALPDPGVVFDVLLRRQEFKEHPTQISSLFFAFANIIIHSLFRTSHSQSTSTINDTSS
YLDLSPLYGHNEDAQNKVRIKDGRGLMKEDTFADERLLMMPEAVGALLVLFCRNHNYIAR
RILLINEQGKFRDPTDEWCAKNPTAADEQDDEIFNKARLVNCGYFMQVILGDYLGSILGT
VREGSDWCLDPLQSIRTLTHELVPRGEGNVISVEFNLLYRWHATLSKQDEEWLTNDVYGK
MFPGKSPDTITSREFLMGVRSWMHKISKDPGEWNFGSLKRQENGRFKDDDLARVMKEATT
NVAGAFGARGTPGVLRVVEIMAIEQARNWGVCSLNEFRKFMGLKPYSSFEEWNPDPSIHE
PATRLYGDIEHLELYVGLQAEEAKSPRPGAGLCPGFTISRAILADAVCLVRGDRFLTTDF
TPFNLSSWGFQDCARDLNNGSFGGQLSKLLMRTLPDHYNDRSIYAHFPMITPPGVHGILA
KLDLVEKYDFEMNSSIKTTRVVETATACRNVLKDWRNFPVAYASFMKDITDGYGMYLAHN
DTVKHRRDRLLIRDALFAPGQIDLYARYYFDMTRKLIREKSYTLVGSDVRSVDIVRDVVN
LVPVHWVTEHVAGIPLKTHENPRGAHTEMEVYQMTARMFEFMFLNTRPVAGWNLREQSIE
FSQLFLGEIKAHLQEIAKGHFSLSGAKDALIHWIVGQNSHAHDFLRRLYSMNTTATLDEL
AYSVLGTVVASVPDYGQAAAHVINFYLEEHHRAQKEHICRLALRVDDESNRLLTGYVLEA
LRLDPQTPGLFRDVAADTEVDQGPNMPKIRLNRGERVFVSLARANVDTEAFGVNCERTID
PERAHRDYLLFRHGAQTMLNDEFLEKTMPQVIRAVFSLKNIRRAPGRSGHLNRFEVDWHG
AQRKLYVNAKGTITPWPESLVIQYDV
NT seq 3501 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgacgctgacgcgcgcagcagcgagcgcgtacgacgcggcggcgcaggtcgcg
aacctcgccgtgctcgcgcagcgccccatcctcgacgacggcaagcacgacacccacacg
gccggcctgcgcgcgctcgagagcatcaagagccagttcaagctcggcctgccgctgctg
cccagcgcggccaacgtcgacgccatcatggacgcgctcgcgcacgccgacagcggcatc
gacgaccgcaaatggctgctagaggaggtcctcatgatcctcgccaagctgccgcgcggg
tcatggctcagcaccgtgctcgagaaccggattgtcgagctgttctacagggacctgccg
cacccaccctccacgttcctaggccgcccgccgctgctcccgtcatacctcgcgtcgagc
gtctcctcacccaacgtttctccacagaacagcattctcatcgggaagtcatacagcaat
ggcaatggcagcggcagttggtccaacggaaatggcagcggggtgctgagtggcatgccc
aacggctatgcgcttgggtcaaacgaccccgccgcgaccgcgtacccgccaccggacgtg
ttctcgggcaagccgtacgcccaccgcatgcccgacgggtcgaacaacaaccctctgttc
cccgatctcggccgcgcaggcatgccctacgcgcgcaccgtcccacccagcaaccccgtg
ccgcagtccgccctcccggaccccggcgtcgtctttgatgtccttctcaggcgccaggag
ttcaaagaacacccgacgcagatctcgtcgctcttcttcgcgttcgcgaatatcatcatc
cactcgctcttccgcacgtcgcactcccagagcacgagcacgatcaacgacacctcgtcg
tacctcgatctgtccccgctctacgggcacaacgaggacgcgcagaacaaggtccgcatc
aaggacggccgcggtctcatgaaggaagatacatttgcggacgagcgcctgctcatgatg
cccgaagcggtcggcgcgctgctcgttctcttctgccggaaccacaactacatcgcacgc
cgcatcctgctcatcaacgaacagggcaagttcagggacccgacggatgaatggtgcgca
aagaacccgaccgccgcggacgagcaggacgacgagatcttcaacaaagctcggctcgtc
aactgcggctacttcatgcaagtgattctcggcgactaccttggctcgatcctgggcacc
gtgcgcgagggctcggactggtgtctggacccgctccagtccatccgcacgttgacgcac
gagctcgtgccgcgtggcgaggggaacgtcatctccgtcgagttcaacctgctgtacagg
tggcacgcgacgctgtcaaaacaggacgaggagtggctcaccaacgatgtctatgggaag
atgttcccaggcaagtcgcccgatacgatcacaagcagggagttcctcatgggcgtccgc
tcgtggatgcacaagatctccaaggaccctggggagtggaacttcggctcgctcaagcgc
caggagaacggccgcttcaaggacgatgatcttgcgcgcgtgatgaaggaggcgacgact
aacgtcgctggtgccttcggagcgcgcggcacgcctggtgtcctccgcgtcgtcgagatt
atggcaatcgagcaggcccgtaactggggcgtgtgctcgcttaatgagttccgcaagttc
atgggcttgaagccctactccagcttcgaggagtggaaccccgatccctcgatccatgaa
ccggcgacgcgtctttacggcgacatcgagcatctcgagctttacgttggcttgcaagct
gaggaggcaaagtcgcctcgcccgggagcgggtctgtgcccggggttcaccatctctcgc
gctattctcgcagatgccgtctgcctcgtccgaggagaccgcttcctcaccacagacttt
acgccgttcaacctctcgtcgtggggctttcaggactgcgcgcgcgacttgaacaatgga
tctttcggcgggcagctctcgaagctgctcatgcgcacgctgccggaccactacaacgac
cgcagcatctacgcgcatttcccaatgatcacgccgcccggcgtgcacggcatcctcgcg
aaactcgacctcgtcgagaaatatgacttcgagatgaactcgagcatcaagaccacgcgc
gtcgtcgagaccgctacggcgtgccgcaacgtcctcaaggactggcgcaacttccctgtc
gcgtatgccagctttatgaaggacatcaccgatgggtacggcatgtacctcgcgcacaac
gataccgtcaagcatcgtcgcgatcggctgctgatccgcgacgccttgttcgctcccggc
cagatcgatctctatgctcggtactacttcgacatgacccgcaaactcattcgtgagaag
agctacacccttgtgggcagtgatgtccgctccgtggacattgtgcgcgacgttgtcaac
ttggttcctgtccactgggtcaccgagcacgtggcgggcattcctctcaaaacgcacgag
aatcctcgtggtgcccacaccgagatggaggtataccagatgacggcgcggatgttcgag
ttcatgttccttaacacccgcccagtggctggctggaatctgcgagagcagtcgattgaa
ttctctcagctgttccttggagaaatcaaggcgcacttgcaggagatcgcgaagggccac
ttctcgctctccggcgccaaggacgcgctcattcactggatcgtgggccagaatagccac
gcgcacgacttcctccgcaggctgtacagcatgaacactactgctaccctcgacgagctc
gcgtacagcgtgctcgggacggttgtggcgagcgttccggattacggccaagctgctgcc
cacgtcatcaatttctatcttgaagaacatcaccgtgctcagaaggaacatatctgccgc
cttgcccttcgggtagacgatgagtcgaatcgtctccttactggttacgtgctcgaagcg
ctccgtcttgaccctcagactccaggtctattcagagacgtcgctgcggacactgaggtc
gatcagggtcccaatatgccgaagatccgtctcaaccgcggcgagcgtgtcttcgtcagc
cttgcgagggccaacgtcgacacggaggcattcggagttaactgcgagcgtaccatcgac
cccgagcgcgcgcaccgggactacctgctgttcaggcatggcgcccagacgatgctcaac
gacgagttcctcgaaaagacgatgccgcaggttatccgtgctgttttcagcctcaaaaat
atccgccgcgcgcctggtcgctctggacacctgaacaggttcgaagtcgattggcacggc
gctcagcgcaagttgtatgtcaacgccaagggcaccatcacgccgtggccggaatccctc
gttattcagtatgatgtgtaa

DBGET integrated database retrieval system