KEGG   Auricularia subglabra: AURDEDRAFT_134103Help
Entry
AURDEDRAFT_134103 CDS       T03129                                 

Definition
(RefSeq) glycoside hydrolase family 13 protein
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
adl  Auricularia subglabra
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AURDEDRAFT_134103
Enzymes [BR:adl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AURDEDRAFT_134103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 524 aa AA seqDB search
MRALATLLPWIPLALAATAEQWRGQSIYQVMVDRFAHPSRTNATCDPGAHKICGGTWVSL
RENLDYIQGMGFTAIWISPVNKNIEGPTAYGETYHGYWVTDISQLNERFGTADDLKALSD
ELHKREMLLMVDVVVNNVVSTTIEPDYSQYFFKEASQYHPYCPIAYGNRTSEEYCRMGDR
NLTLVDVNTEDDFVVQQYNIWIAALVKTYDIDGLRIDGPHVRASFWPGFCAAAGVFCIGE
VYTKAIEQSLEYTAVMDSVLNFPTYHSLVEAFQIPGPLNMSALASNFADSKAQFNSTLVL
GNFLENQDVPRWANMSVDPQSLYNAMTYTFMWDGIPVVYNGQEQGFRGAADPWNREALWT
SGYANTTAYQLIAKLNALRKFLATTRPEWLASQASILTLTQNNIAFIKGPTITILTNIGS
PPQNTSVAVYTPFQPNLATTDVLSCTQFATGSDSTVSVSYSSGGRPVVLIPSVYLYGSGF
CGHEAIATAATGGSPGTGTLLSWRTRVQLLVTAAGVTAWLGIVL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcactcgctaccctcctcccgtggatccctttggctcttgcggcaacggcagag
caatggcgtgggcagtccatatatcaagtcatggtggaccgcttcgcgcatccaagtcga
acgaatgcgacatgcgacccgggagcacacaaaatttgcggcggtacatgggtgtccttg
cgcgagaacctggactatattcagggaatgggcttcaccgccatttggatatcccctgtc
aacaagaacatcgagggacccacggcgtacggagagacataccatggatattgggttacc
gacatcagccagttgaatgagaggtttggcacggcggacgatctcaaggcgctctcggat
gagctgcataaacgagaaatgttgctgatggttgatgtcgtcgtgaacaacgtggtttcg
acgacgatcgagcctgactactcgcaatactttttcaaggaggcctcgcaatatcacccc
tactgcccaattgcttacggaaaccggacttccgaggagtactgccggatgggcgatagg
aatctgacgctggtggacgtcaacaccgaggacgatttcgtcgtccagcagtacaacatc
tggatagcagcgctcgtcaagacatatgacatcgatgggcttcgtattgatggtccgcac
gtgagagcgagcttctggccgggtttctgtgctgcagcgggcgtgttctgcattggggag
gtgtacacaaaggcgatcgaacagtcgctggagtacaccgccgtgatggactcggtgctc
aacttccccacgtaccacagcctcgtagaagccttccagataccgggcccgctgaacatg
tccgcgctggcgagcaacttcgccgactccaaggcgcaattcaactcgactttggtgctg
ggcaacttcctcgagaaccaggacgtaccgcgctgggcgaatatgtccgttgacccgcag
agcctgtacaacgcgatgacgtacacgttcatgtgggacgggattcccgtcgtgtacaac
gggcaggagcagggcttccgcggggccgcggacccgtggaaccgcgaggcgctgtggaca
tcgggttatgcaaacaccacggcgtaccagctcatcgcgaagctcaacgcgctccgcaag
tttcttgccacgacacgtccggagtggctcgcgtcgcaggcgtccatcctcaccctgacg
cagaacaacatcgcgttcattaagggcccgaccattacgatcctcaccaacatagggtcg
ccgccgcagaacaccagtgtcgccgtctacacgccgttccagccgaacctggcgacgacc
gatgtgctgagctgcactcaattcgccacgggcagcgatagcacggtgtcggtgtcgtac
tccagtgggggccggccggtggtgctgatcccgagcgtgtatctgtacgggtccgggttc
tgcgggcacgaggcgattgccactgcagcgacgggcggcagtccgggcacgggcacttta
ttgtcctggagaacgcgagtccagcttctggtgacggctgccggagtgacggcatggctc
gggatcgttttatga

DBGET integrated database retrieval system