KEGG   Arachis duranensis: 107463705Help
Entry
107463705         CDS       T04300                                 

Definition
(RefSeq) thymidine kinase a
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
adu  Arachis duranensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    107463705
Enzymes [BR:adu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     107463705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
A09
AA seq 228 aa AA seqDB search
MASFKHPTPFISGKDRYPSGEVHVIVGPMFAGKTSSLLRRIKSEVDNGRNVAMLKSSKDT
RYAIDSVVTHDGIRFPCWALQDLMSFQEKYGHDAYRKLDVIGIDEAQFFEDLYEFCCKAA
DEDGKIVIVAGLDGDYLRKSFGSVLHIIPLADTVTKLTARCELCCKRAFFTLRKTQETQT
ELIAGSDVYMPVCRYHYINSEVVTETSKNVLESVKCNNDSLLDVATSF
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcttccttcaagcacccaactccctttatctccggcaaggatcgttacccttctggc
gaggtccatgttattgttggtcccatgtttgcaggaaaaacttcttcccttcttcgccgt
atcaaatccgaagttgacaatggcagaaacgtggctatgttaaaatcaagcaaggataca
agatatgccattgactcggttgtgacacatgatgggattagatttccttgttgggcattg
caagatctgatgtcattccaagaaaaatatggtcatgatgcttatcgaaagttggatgtg
attggtatagatgaagctcaattttttgaggacctatatgagttctgctgcaaggctgct
gatgaagatggtaaaattgtgattgttgctggcctggatggtgattacttgaggaaaagc
tttggttctgtgcttcacataataccgcttgctgatactgtaaccaagttgacagctcga
tgtgaattatgctgcaagcgtgctttcttcactctcaggaaaacacaagagacacaaact
gaactgattgctggttctgatgtctacatgccagtgtgccgatatcactatattaacagt
gaagttgtcactgaaacttcaaagaatgtgttggaatctgtcaaatgcaacaatgattca
cttcttgatgtagccacaagcttttag

DBGET integrated database retrieval system