KEGG   Arachis duranensis: 107466699Help
Entry
107466699         CDS       T04300                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial isoform X1
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
adu  Arachis duranensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:adu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107466699
   00020 Citrate cycle (TCA cycle)
    107466699
   00620 Pyruvate metabolism
    107466699
Enzymes [BR:adu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     107466699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
A09
AA seq 635 aa AA seqDB search
MALSLSRLRHPLISRSLRLLSSSSSVSRSLSRTSKSGIFSVGCDEHQRLTSLSRLTGVCD
NSLKPKWFGIRYFSSADSSHIVIGMPALSPTMTQGNIAKWRKKEGDKIEVGDILCEIETD
KATLEFESLEEGFLAKILVPDGSKDVPVGQPIAITVEDQDDIKNVPASVGSGTEVKEKKP
IHQDDSAEERKPEPTSTDINASELPPHILLEMPALSPTMNQGNIAKWRKKEGDKIEVGDI
LCEIETDKATLEFESMEEGYLAKILAPEGSKEVAVGQPIAITVEDAGDIEAVKNSSGGRS
ASKNEQTTKHDTKTEVKPQKTSSKRISPAAKLLISEYGLDPSTINASGPHGTLLKGDVLS
AIKSGKLTPKPYSAKEKASPSQSHQQSAASPESKSASASKQSDAYEDLPNSQIRKVIAKR
LLESKQNTPHLYLSSDVTLDPLLSLRKDLKEQYDVKVSVNDIIIKVVAAALRNVPEANAY
WDAEKGEVVLCDSVDISIAVATEKGLMTPIIRNADHKTISAISSEVKELAAKARDGKLKP
QEFQGGTFSISNLGMYPVDKFCAIINPPQACILAVGRGNKVVEPIIGSDGIEKPAVVNKL
NLTLSADHRVFDGKVGGAFLSALKSNFSDIRRLLL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggctctttcactgtcgcggcttcgtcaccctctcatctctcgctcccttcgcctcctt
tcctcttcctcttccgtttccagatccctctctcgaacttctaagtcagggattttctct
gtgggttgtgatgagcatcaaaggcttacatctttgtctaggcttacaggagtctgtgat
aattctttaaagccaaagtggtttggtatcagatacttctcatctgcagactcatcacac
atagtcattgggatgcctgctttatctcctacaatgacccaaggtaacattgcaaaatgg
agaaagaaagaaggagataagatagaagttggtgatatactatgtgaaattgaaaccgac
aaggctacacttgaatttgaaagtcttgaagaaggatttcttgctaagatattggtacct
gatggttcaaaggatgtgccagttggacaaccaattgcaataacagttgaggatcaagat
gatattaaaaatgtccctgcttctgtgggaagtgggactgaggttaaagagaagaaacca
atacatcaggatgactccgctgaggaaaggaaaccagaaccaacgtccactgacattaat
gcatcagaacttccacctcatatccttcttgaaatgccggctttgtccccaacaatgaac
caaggcaacattgctaaatggaggaaaaaagaaggcgacaagattgaagtgggtgacata
ttatgtgagatagagacagacaaagctacccttgaatttgaaagtatggaggaaggatac
ttggctaagatacttgcaccagaaggttcaaaagaagtggcagttggacaacctattgca
ataacagttgaagatgcaggtgatattgaagctgtaaagaattctagtggtggcagatct
gcaagcaaaaatgagcagaccaccaaacatgatactaaaactgaggtgaaaccacagaaa
actagttcaaaaagaattagcccagctgcaaagttgctaatttcggaatatggattggat
ccatcgacaataaatgcctctggtccacatggcactttactgaaaggggatgttctgtct
gcaattaaatcaggaaaattgactccaaaaccttattcagctaaagagaaggcatcacca
tctcaaagtcatcaacaatctgcagcttcaccagagtcaaagtctgcttctgcctcaaag
cagtcagatgcatatgaagatcttcccaatagtcaaattcgcaaggttattgcaaagagg
ttgttggaatcaaaacaaaacacaccacacttgtatttatcatcagatgttactttggat
cctcttctctcccttagaaaagatcttaaagagcagtatgatgttaaagtttcggtgaat
gacattattatcaaagttgtagcagctgctctcagaaatgtcccagaagcaaatgcgtac
tgggatgctgaaaagggtgaagttgttttatgtgattctgttgacatatctatagcggtt
gccactgagaagggcttgatgactccaataataagaaatgctgatcataagacaatatct
gccatctcgtctgaggtcaaggaactagcagcaaaggcacgtgatggcaagttgaagcca
caagaattccaagggggtacttttagcatttcaaacttaggaatgtatcctgtggataaa
ttctgtgctattataaaccccccacaggcttgcattcttgctgtagggaggggcaacaaa
gttgtggaaccaataattggatctgatggaattgagaagccagcagtcgtcaataagttg
aacttaacattatcggctgatcatcgtgtttttgatggcaaagttggaggtgcatttctc
tctgctttgaaatcaaacttcagtgatataagaaggcttcttttataa

DBGET integrated database retrieval system