KEGG   Arachis duranensis: 107476467Help
Entry
107476467         CDS       T04300                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
adu  Arachis duranensis
Pathway
adu03030  DNA replication
adu03410  Base excision repair
adu03420  Nucleotide excision repair
adu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:adu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    107476467
   03410 Base excision repair
    107476467
   03420 Nucleotide excision repair
    107476467
   03430 Mismatch repair
    107476467
Enzymes [BR:adu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107476467
    6.5.1.6  DNA ligase (ATP or NAD+)
     107476467
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107476467
DNA replication proteins [BR:adu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107476467
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107476467
DNA repair and recombination proteins [BR:adu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107476467
   NER (nucleotide excision repair)
    Other NER factors
     107476467
   MMR (mismatch exicision repair)
    Other MMR factors
     107476467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DUF4820
Motif
Other DBs
NCBI-GeneID: 107476467
NCBI-ProteinID: XP_015951768
LinkDB All DBs
Position
A03
AA seq 837 aa AA seqDB search
MLAFRPCFFNPPLCRPISVKVLSFFAFPSSLSSHILSLPFPHRTMTKPPSAFDALMSGAR
AAAAAAAKKKKSEQSQQPTVSSPKKRKPSPSTLPTPTSTLNPNDPKPSETVPTPTSDPPK
QEPEKEGPPPTKTRHVSSSSALQELKKRIPQLKAKPSKFDPSSVACWEKGTPVPFSLLAL
ALEMISAEPGRIKMTDIVCNLMKTVIYSTPEDLVPLIYLFAKRVAPAHEGLELGIGETSI
IKALAEATGSTESKIKKQYQGEGDLGRVAKICRSSQSMMRKPEALTIRKVFNTFRLIAKE
SGRDSQKKKKNHIKALLVAATDCEPQYLICLLQGKLRIGVAEQTLLAALGQAAVQSEEHS
KPPDGIKSPLEEAVKIVKQVYSVLPVYDEIVSALLTHGVWKLPSTCNFTPGIPVGPMLSK
PTKGISDILNSLQDVEFTCEYKYDGERAQIHYMENGSVEIYSRNAERNTGKFPDVVAAIS
RLKKSTVSSFVLDCEIVGYDREKQTIRSFQDLTTRPRKNVSVDNIKVDVCIFAFDILYLN
GRVLLQDNLKIRREHLYASFEEETGVFQYATAITSNDIEEIQKFLDKAVASSCEGLIIKT
LSEDSTYEPSNRSHNWLKLKKDYLDNIGDSLDLVPIGAFYGRGKRTGVYGAFLLACYDYN
NEEFQSICKIGTGFTEDVLEQRSKSLGSQVIPGPKRYYQCGDKMKPDVWFEASEVWEVKA
ADLTISPVYRAAVGIVDSDKGISLRFPRLVRVRPDKTPEQASSSEQVAEMYNAQKAAQTK
EKEKEKNKQDGSESPKKQIGSESPKKQIGSEDKDEDEVADEDEDEDVDVDADEDEDK
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcattccggccatgcttcttcaatccaccactctgccgccccatttccgttaaa
gttctctcctttttcgcatttccttcttctctttcctctcacattctctctctccctttc
ccccatcgcacaatgaccaaaccaccctccgccttcgacgctctcatgtccggtgctcgc
gctgccgccgccgccgctgccaagaagaagaaatccgagcagtcgcagcaaccaactgtt
tcttctcccaagaaacgaaaaccttcaccctccactctccccactccaacctccacgcta
aaccctaacgaccccaaaccctccgaaaccgttcctacgccaacgagtgacccgcccaag
caagaaccggagaaagaaggccctcctccgaccaagactcgccacgtgtcttcttcatct
gccttgcaggagctgaagaagcgcattccgcagctgaaggcgaagccttcgaaattcgat
cctagctcagtggcttgttgggagaagggcacgcctgtgccgttctcgttgctggctttg
gcgcttgaaatgatttctgcggaacctggcagaatcaagatgacagatattgtgtgcaat
ttgatgaagactgtgatatactctacccctgaggatcttgtgcctctgatttatctcttc
gcgaagagggttgctccggcgcatgaagggctggaattgggaattggcgagacttcgatt
attaaggcacttgctgaggcaactggaagtactgaatccaaaatcaagaagcagtatcag
ggcgagggtgatttgggaagagttgccaagatatgccgttcatctcagtccatgatgcgg
aagcctgaggctctgactattaggaaagttttcaacaccttccgtcttattgccaaggaa
tctggaagagacagtcaaaagaagaaaaagaatcatataaaggcacttcttgttgctgca
actgactgcgaacctcaatatcttatctgtcttctacagggaaaattgcggattggtgtg
gctgagcaaactctcttagctgcattaggccaagcagcagtacagagtgaagaacattct
aaaccacctgatggcattaagtctcctttggaagaggctgtaaaaattgttaaacaagtc
tactctgttcttcctgtctacgacgaaatagtatctgcacttcttacgcatggtgtatgg
aaacttccatcaacatgtaattttactcctggtattccagttggacctatgctgtcaaaa
ccaacgaagggtatctctgatattctaaattcattgcaagatgtggagtttacttgtgaa
tacaagtatgatggagagcgtgcccagatacattacatggaaaatggttcagttgagatt
tatagtagaaatgctgagcggaatactgggaagtttcctgatgttgttgctgcaatttca
aggttaaagaaatcaactgtatcatcatttgttcttgattgtgaaattgttggatatgat
cgtgagaaacagaccatccgttccttccaggatcttactactcggcctcgtaaaaatgta
tctgtggataatataaaggttgacgtctgcatatttgcttttgatatactgtatcttaat
ggccgagtacttcttcaggataacctgaaaatccgtagagagcatctttatgcctctttt
gaagaagaaactggagtttttcagtatgcaacggcaataacatcaaatgacattgaggaa
attcagaaatttctcgacaaagctgttgcgtcaagctgtgagggattaatcattaaaact
ttaagtgaagattctacatatgaaccttccaatcggtcacacaattggctaaaactgaag
aaagattatctggataacataggggactcactagatttggtacctataggtgcattctac
ggacgtgggaaacgtacaggagtctatggtgcttttcttcttgcttgctatgactacaat
aacgaagaatttcaaagtatttgtaagattggaacgggatttactgaagacgtgctcgaa
cagcgttctaaaagtcttggttctcaagtgattcctgggccaaagcgatactatcaatgt
ggagataaaatgaagcctgatgtctggtttgaagctagtgaggtgtgggaggtgaaagct
gcagatttgaccattagcccagtttaccgagctgcagtgggcatagtagattcagataag
ggcatatctcttagattcccacggctagttcgagttcgacctgacaaaacacccgagcag
gcctcatcatctgagcaggttgctgagatgtataatgctcaaaaagccgctcaaactaaa
gaaaaagaaaaagaaaaaaacaaacaggatggtagtgagtcaccaaaaaaacagattggc
agtgagtcaccaaaaaaacagattggcagtgaagacaaagacgaagacgaagtcgcagat
gaagatgaagatgaagatgtagatgtagatgcagatgaagatgaagataagtga

DBGET integrated database retrieval system