KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105144272Help
Entry
105144272         CDS       T03917                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase, mitochondrial isoform X1
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aec00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    105144272
   00650 Butanoate metabolism
    105144272
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105144272
   00280 Valine, leucine and isoleucine degradation
    105144272
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105144272
Enzymes [BR:aec01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     105144272
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     105144272
Amino acid related enzymes [BR:aec01007]
 Aminotransferase (transaminase)
  Class III
   105144272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MLVNKYHRALSGRISLRQLLNGITTWKRCLTGSMPREPEGPVLMTEIPGPRSRSLLQELS
SIQQASSVQFFADYEKSAGNYIIDVDGNVLLDVYMQISSMPLGYNHPAMLEALADPVNQR
IIVNRPALGVFPGKDWPNRLRDVLLKKELAPPGLSHITTMMCGSCSNENAFKNIFIWYAE
KQRQGKPFTKEEIESCMMNQIPGSPRYSIMSFKGSFHGRTLGCLSTTHSKYIHKMDIPAF
DWPIASFPEYKYPLEENVRENKQEDKRCLAEVEELFEKYKNEKKIPVAGVIIEPIQAEGG
DNHASPEFFQELQRLIRKYGAALLVDEVQTGGGPTGKMWCHEHFNLDTPPDIMTFSKKMQ
LGGYYHSEDLKPKLSYRVFNTWMGDPSKVILLETIIKTIKKENLLDRVTCVGNYLLKHLM
DMQKEHTNVISAVRGRGTFIAFNCPSSEARDSIIKKLATKGIQTGGCGSQAVRLRPALTF
TEHHADIFLDTLRSILKK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttaacaagtatcatcgtgcgttgagtgggcggatctcgctccgacagctgcta
aacggcattactacgtggaagagatgcttaaccggttcgatgccgagggaacctgaaggg
ccggtacttatgaccgaaataccaggccctcgatcgcgcagcttgctacaagaattaagt
tcgatacaacaagcgtcttccgtacaattcttcgcagactatgaaaaatccgccggtaat
tacataattgacgttgatgggaatgtgttgctggacgtttatatgcaaatctcatcaatg
cctctagggtacaatcatccggcgatgctggaggctctcgccgatcccgttaatcaaaga
attatagtgaatagacctgctttaggtgtctttccaggaaaagactggcctaatagatta
agagatgttctacttaagaaagagttagcaccaccgggattatcacacattacgacaatg
atgtgcggttcttgttctaatgagaatgcttttaaaaacatttttatctggtacgccgag
aaacaaaggcaaggcaaaccgttcacgaaggaagagatagaatcgtgtatgatgaaccaa
atccctggctcaccgcgatactctattatgtcctttaaaggtagctttcatggaagaacc
ttaggttgtctctcaacgactcacagcaagtacattcacaagatggatataccagctttc
gactggcctatcgcctcctttccagagtacaaatatcctttagaagaaaacgtgcgagaa
aacaagcaggaagataagcgttgcctcgcagaggtcgaggaattatttgagaagtacaaa
aacgaaaagaaaataccagtggctggtgtgataattgaacctattcaagcagaaggcggc
gacaatcacgcatccccagaattctttcaggaacttcaacgcttgatacgaaagtatgga
gccgcgttacttgtcgacgaagtgcaaaccggtggcggaccaacgggaaaaatgtggtgc
cacgagcactttaatttagatactccacccgacataatgactttcagcaagaaaatgcaa
ttaggcggttattatcattcggaggatctgaaaccgaaactgtcatatcgtgtgttcaat
acttggatgggcgatcccagcaaagtgatcctgctcgagacgattataaaaacgattaaa
aaagagaatcttttggatagagttacgtgcgtgggcaattatctgttaaaacatttgatg
gatatgcaaaaggaacataccaatgtaattagtgcagtgcgcggacgtggtactttcata
gcatttaattgcccctcgtctgaagcgcgagatagcatcatcaagaaacttgcaacgaaa
ggtattcagacaggtggctgcggcagccaggctgtgcggctgaggcctgcgttgaccttc
acagagcatcatgccgatatatttctggatacgcttcgctctattttaaaaaaataa

DBGET integrated database retrieval system