KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105149150Help
Entry
105149150         CDS       T03917                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
Enzymes [BR:aec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105149150
Peptidases [BR:aec01002]
 Metallo Peptidases
  Family M2
   105149150
Exosome [BR:aec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105149150
CD molecules [BR:aec04090]
 Proteins
  105149150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 683 aa AA seqDB search
MKFAFSGTSGMLDRVSSSFVRWTVLLLCLLSAISGQLDLPPYRDEDAAQQLPPNEINYQN
ILARLDFLGAERCSANVIAQWAYETNVNEYTQLQALDAQRLYADFQYQAWLLISRIDINS
IRDPIIRRRLRYLSVVGPSALPPDQLDRYNRLINDMLAIYNAATICAYNDPFRCGLRLYP
DISQIMAKSRDWDELQYVWTEWRRRSGRPIRDLYHQLIALTNDAARMNNFTDAAEYWMFP
YESPNFQQDIDEAWETIRPLYEELHAYIRRRLRDLYGPEKIGAHTPLPSHILGKNNVDVT
INYLHGKNNFEVDLKIKLEGYTPIDMIRVAEEFYLSLNLSAMPPEFWAGSVFADPGDRPL
ICQASAWDFCNRIDYRIKMCTKVTMKDLITLHHEMAHIQYFLRYSGLPREFRDGANPGFH
EAVGEAVALSVTTPQHLQTLGLANTFIDERSADINYLFALAMDKLVLLPFSIAMDRWRWD
VFRGYVNKEEYNCHWHRLKEQYTGTKPPVLRSEDDFDPGAKYHIPANIPYIRNFVAGVLQ
FQLYRALCQAAGQRSEIDNPRRPLHRCDFYRKPEAGRILGRLMERGSSIPWRDTLGEAIG
ESRLDGSALREYFRPLEDWLRTENLRTGEVVGWSYDGDFCKRSIETAGLQVYGSGFYNSG
TSISVSWIVTGIMMVLWIVSTLY
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgccttcagtggaaccagcgggatgttggaccgcgtcagcagcagcttcgta
agatggacagtgcttttactctgtctattatcggcaatttccggtcaattggacctaccg
ccctacagagacgaagatgctgcccaacaactaccacccaatgaaataaattaccagaac
atcctagctagattagattttctaggcgcagaaagatgtagcgctaatgtaatagctcaa
tgggcatacgaaactaatgtcaacgaatacacgcagctacaagcgctggatgcccaacgc
ttatacgcggatttccaataccaagcatggcttttaatctcgagaatcgacataaattct
attcgggaccccatcatcaggcgacgactccgttatttgtccgtggtgggtccttcggca
ctaccacctgatcaactggacaggtataatcgcttaatcaacgacatgcttgcgatttat
aacgcagcgaccatatgcgcttacaacgatccgttccggtgtggactgcgtttatatcca
gatatatcgcaaatcatggcgaaaagtcgggactgggacgaattgcagtacgtctggacc
gaatggagaagacgaagtggcagaccgattagggatctatatcatcaacttattgcgctg
accaatgatgctgcaagaatgaataactttactgatgccgccgaatattggatgttccct
tacgaatctcctaatttccaacaagacattgatgaagcttgggaaacgatacgtcctctt
tatgaagaattacatgcttatattcgcagaaggctgagagatctctacggtcctgaaaaa
attggcgcacacacgcctcttccgtctcacattctcggtaaaaataacgtcgacgttaca
attaattacttacatggaaagaacaattttgaagtagatctgaaaattaaactagagggc
tacactcctattgacatgattcgagtggccgaggaattctatctgtccttgaatttgagc
gcaatgccaccggaattttgggccggaagtgtattcgccgatcctggcgaccgtccatta
atttgtcaggcgtctgcatgggatttttgtaatcggatagattacagaatcaaaatgtgt
acaaaagtgacgatgaaggatttaataactttgcatcacgaaatggcacacattcagtat
tttttgagatacagtggtctacctcgagaatttcgtgacggcgctaatccaggattccac
gaggcggtcggcgaagccgtcgccttgagcgtcacgacgccacagcatctgcaaactctg
ggcctggcgaacacgttcatcgatgaacgctcggcagacataaactacctcttcgccctg
gcgatggataaactagtgctgctacccttcagcatcgcgatggataggtggcgatgggac
gtcttccgcggctacgtcaataaagaggagtacaattgtcattggcacagattgaaggag
caatacacgggcacgaaaccaccagttctgcgatccgaggacgatttcgatccaggagcg
aagtatcacatcccggccaatattccctacatacggaattttgtggctggggtcctgcaa
ttccaattgtatcgagcattatgccaggctgcgggtcaaagatccgaaatcgacaatccg
aggaggccgctgcacagatgtgacttttatagaaagcccgaggccggcaggatcttgggg
agattgatggagaggggctcatccatcccgtggcgggatacgttgggagaagctatcggc
gagtccagattagacggatccgctcttagggagtacttccggccattagaggactggttg
aggaccgaaaatttgaggacgggcgaagtagtcggctggtcatacgacggagacttttgc
aagaggagcatagagactgcgggcttgcaggtttacggtagtggcttctacaacagcggc
acatccatctccgtgtcttggatcgttacgggaatcatgatggttctttggattgtatca
acactttattga

DBGET integrated database retrieval system