KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105149380Help
Entry
105149380         CDS       T03917                                 

Definition
(RefSeq) histone deacetylase 6 isoform X1
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
Enzymes [BR:aec01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     105149380
Protein phosphatases and associated proteins [BR:aec01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105149380
Messenger RNA biogenesis [BR:aec03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     105149380
Membrane trafficking [BR:aec04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    105149380
Chromosome [BR:aec03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     105149380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1173 aa AA seqDB search
MTESTVNLDLFTAAKQLADSEIELIKVIENSTKCQRTATNMLSNAKKTKKSGKSKNARPS
AALLAAKQEAAKRQLLSDKKSNNNFVPDIYQKAIDAYKMIRKETGLVFDRSMAEHECIWD
SNYPECPARFTRVLQRCEELGLVQRCKLIEPRRATENELLSKHSQKQIDILKATDDSMDS
ENLELLSSKYDCVYIHPSTYRLSLLAVGSTINLVESICKGEIQNGMAIIRPPGHHAMKSE
YCGYCFFNNVALAVEKALNFSLANRILIVDWDVHHGQATQQMFYNDPRVVYFSIHRYEHG
EFWPNLRESDFHYIGEELGEGYNFNVPLNKTGMTNADYIAIFQQVLLPMAYEFQPDLIIV
SAGYDAALGCPEGEMLITPACYSHLLSSLLSLANGKVAVVLEGGYCLKSLAEGAALTLKT
LLGDPCPVLQTLDLPSLSIRDTILNVIYSHKPYWKCYQYQDTHSINSVTHSKEEIANRHV
VTMTFKGSEVKLEKYDTRNCYPVQSKETLEVMEKKLNELIQLTNLYKAPHKVCIVYDEKM
QKHCNISDNSHPEKPNRISSIYKNHEEHGLLQRCHLLQGRNATIEELSLIHAIDHIDDIK
RTSTLKLKELQKQASDYNSVYLHFETWSSACISAGSLLQVVDAVLNGECQSGVAIVRPPG
HHAEKDIACGFCIFNNVAVAAMYAVQFYHVNRVLIVDWDVHHGNGTQSIFEEDPKILYIS
VHRYDNGNFFPNSKLANYTSTGLNAGEGFNVNIPWNKKGMGDAEYIAAFQQIVMPIAYQF
NPELVLISAGFDACIGDTLGGCFVSPELYGHLTHWLLSLANGRIILSLEGGYNINSISHA
MTMCTKALLGDPLPMLDLNLIPCTSAINSINNVLKTHKKFWPNLQYGMSLPKERLFSKFK
TIPNNREEQGKNADKLKQIFMEPKIALEGIESEKLDLNLAIDKNCLNLVTDEEISKLTCE
VENIKIKNFELHAKKNEAVGAKRNPELKQSEAKNLNVSQSIQKCVNETHQSRGSQQENSD
IHEDRDDEGAASSQSGTRPITLSEYLSDNLQALTAGEMFAIVPLQDCPHLFTVNEVPPGG
IDVTTPCAECASIAENWICLQCYTVHCARSINQHAMQHAEEFEHPITLSFSDISVWCYGC
EAYVDNPRLYAARNAAHQSKFNEELPWTYSESA
NT seq 3522 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtccacggtgaacctggatctgtttactgctgctaaacaactagcagacagt
gagattgaactgataaaagtgattgagaattccaccaagtgccaaagaactgcaacaaat
atgctttcaaatgcaaagaaaacaaagaaatctgggaaatcgaaaaatgctcgtccatca
gctgcactattggctgccaagcaagaggcagcaaaacgacagctgctgtcagacaagaaa
tccaacaacaattttgtaccagacatatatcagaaagcaatcgatgcatacaaaatgata
cgcaaggagactggtcttgtattcgatcgaagcatggctgagcacgagtgcatctgggat
tccaattatcccgagtgtccagccagatttacacgagttttgcaaaggtgcgaggagttg
ggcctggtgcagagatgtaaacttattgaaccgagacgtgccacagagaatgagctttta
agtaagcatagtcaaaaacagattgatattttgaaggcaacagacgactctatggattct
gagaatttggagttgctgtcgtccaagtacgattgcgtctatatccacccgtctacatat
agattatctttattagctgtgggctcaacaatcaatttagtagaaagtatctgtaaaggc
gagatacaaaatggcatggctattatcagaccacctggtcatcatgcaatgaaatcggaa
tattgcggttattgctttttcaacaatgtagctctggcagtagagaaagctctaaatttt
agtttggcaaacaggattttaattgtggattgggacgttcatcatggacaagcaacgcaa
caaatgttttacaatgatccacgcgtggtttacttttcgatacatcgttatgaacatggc
gaattctggcccaatttaagggaatctgattttcattatattggagaggaactcggagag
ggttacaactttaatgtacctttaaataaaaccggcatgaccaatgctgattacatcgcg
atcttccagcaagttttattgccaatggcttacgaatttcaaccggatttgataatagta
tcagcgggttacgatgcggctctgggttgtccagagggtgaaatgctgataactccagca
tgttattcacatttgctatcgtcgttgctaagtctggcaaatggaaaagtcgctgtggtt
ttagagggtggttattgcttgaaatcattagcagaaggtgcagcattgactttaaaaacg
ttattaggagatccatgtcctgttttacaaacacttgatttaccatcattaagtatacgt
gatactatcttaaatgtaatctactcacataaaccatactggaagtgttatcaatatcaa
gatacccacagtattaatagtgtaacacatagtaaagaggagattgctaatcgacatgta
gttacgatgacgtttaaaggcagtgaagttaaattagaaaagtatgacactcgaaattgc
tatcctgtacaaagcaaagaaacattagaggtcatggagaaaaaattgaacgaattgata
caattaacaaatttgtataaagcacctcataaagtatgtatcgtctatgatgaaaagatg
cagaagcattgcaacatttctgacaattctcatccagaaaaaccaaatcgcatctccagc
atttataagaatcacgaggaacatggcttattacagcgatgtcatttattacaaggaagg
aatgcaacaatagaagagttatccttgattcatgcaatagaccatatcgatgacatcaaa
aggacatcaactttaaaactcaaagaattgcaaaagcaagcctcagattacaattctgtt
tatcttcattttgaaacatggtcgagtgcctgcatatctgctggctctcttttacaagta
gtggacgcggtcttgaatggggagtgccaatccggagtagccattgtaaggccgcctgga
caccatgctgaaaaagacatcgcatgtggtttttgtatatttaataatgttgccgtggct
gcaatgtatgctgtacagttttaccatgtaaacagagtgctgatagtagattgggatgta
caccatggaaatggaacgcaatctattttcgaagaagatccaaaaatcctttacatctct
gttcatcgttatgataatggtaatttttttccaaattccaagcttgctaattatacaagc
actggcttaaatgcaggcgaaggattcaacgtgaatataccgtggaacaaaaaagggatg
ggggatgctgaatatatagcagctttccagcaaattgtaatgcctattgcttatcaattt
aatccagaactagtcctgatttcggccggatttgatgcctgcattggtgatacacttgga
ggttgtttcgtaagtccagaactctatggccatttaacccattggctcttatccctggcc
aatggtcgtataattcttagtctcgaaggaggttacaacatcaactccatctctcacgcg
atgactatgtgtacaaaggcactcctgggcgatcctttaccgatgttggatcttaatctc
attccttgcactagtgcgatcaattccatcaataatgtactgaagactcacaaaaagttc
tggcccaacctacagtatggaatgtccttaccaaaagagagattattttccaaatttaag
acgattcctaacaatcgtgaagagcaaggaaaaaatgcggataaattgaaacaaatattt
atggaaccaaagattgccttagagggaattgagagcgaaaaactagacttgaacctggcg
attgataagaactgtttgaatctagtgacggacgaggaaatttcgaagttaacgtgcgaa
gtggagaatattaaaataaaaaatttcgaattacacgcgaagaaaaacgaagcggttgga
gcgaaaagaaatcctgaattgaagcagagcgaagcgaaaaatctgaatgtgtcacaaagt
atacaaaaatgtgtgaacgagacgcatcaatcaagaggcagccaacaagaaaattctgac
atacacgaggaccgcgatgatgaaggagcagcatcttcacaatccggaacacgacccata
actctatcggaatatctctctgacaatctgcaggctctgacggcaggagaaatgttcgcg
atcgtgcccctacaggactgtccacatctgttcacagtcaacgaggttcctccaggtgga
attgacgtaactacaccgtgtgccgaatgtgccagtatcgcagaaaattggatttgctta
cagtgctatactgtgcactgcgcccgcagtattaatcagcacgcgatgcagcacgcagaa
gagttcgaacatcccatcacgctcagctttagcgatatttctgtttggtgctacggttgc
gaagcctatgtcgataatcctcgattatatgcggcaagaaacgcagctcatcaaagcaag
ttcaatgaagaacttccctggacttatagcgaaagtgcataa

DBGET integrated database retrieval system