KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105151359Help
Entry
105151359         CDS       T03917                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Brite
Enzymes [BR:aec01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105151359
Peptidases [BR:aec01002]
 Metallo Peptidases
  Family M2
   105151359
Exosome [BR:aec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105151359
CD molecules [BR:aec04090]
 Proteins
  105151359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 669 aa AA seqDB search
MSITDATINLLQRIMTGIRNVIAFFVIVLYGETHGKYLEGLNVNLGDALVFLREYDSAAS
LMCTRVMIAQWNFATNVTDTNHQKMVDEQILKLKFERASWRKAVTFAWSRIPDPLARREL
KMIATKGRSSLTDDKFNEIHRLIAEMKEIYVKARVCSYKQIDGECNLSLDYDLNKIMATS
KDYDELLHYWHAWHEVIGPQLQNKYLRYVQLANRAAKLNGFADAGDQMRELFEDEYFQQN
MAEIMSAITPLYKNLFTYVRSKLIERYGDRIREDGPLPAHVLGDMWSQNWEGLFELVQPF
PASRKLDVTLDMMIQGITPIRMFQIAEEFFTSLGMKPMPPEFWKFSILEKPIDREIKCTP
SAWDFCNRIDYRIKQCTRVTMEDLLSTHYEMAHLQYYLQYKDHPLLFRNEAIPGFHEAVS
DAIGLSIFTRQHLHKIGLHNNLTDNYDSSINFLMLMALRKVAYMPFAYIVDRWRWRVFSD
GVEDMTAHWWELRLQYQGIVPPVPRFERNFDPAAKYHIPADSPYAKYFVSTVLQFQLFQS
LCEISGHIGELHTCDLYRSREAGRLLSDILSMGASRPWQDVVRHMTRSRTNRIDAGAMLK
YFEPLNAWLKRQNEMQPVIGWITSRDDRELFAQWYENNARRIELWSLFPLLVTAKIIIYI
NNYILHPVI
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattactgatgcaacgataaatttactacagagaataatgacaggaattcgaaat
gttattgcgttttttgttattgtgttatatggagagacgcatggaaaatatttggagggc
ctcaacgtgaatttaggagatgctcttgtattccttagggaatatgatagtgcagcttcg
ttaatgtgtacgagagtgatgatagcccaatggaactttgcgacaaacgttactgataca
aaccatcaaaaaatggtggacgaacaaatattaaaattaaaatttgaaagagcttcttgg
cggaaagcagttacttttgcttggagtcgaataccagatcctttggcaagaagggaactt
aaaatgatcgctacgaaaggtcgaagttccctgactgatgataaatttaatgagatacat
cgtttgatagcagagatgaaagagatttatgttaaagccagagtatgttcgtacaaacaa
attgatggcgaatgtaatttgagtttggattacgatctaaataaaataatggcaacgtca
aaagattacgacgaattattgcattattggcatgcttggcatgaagtaattggtccacaa
ttacaaaataaatacttgagatatgttcaattggcaaatcgagcagctaaattgaatggt
tttgctgatgctggcgatcagatgagagagttatttgaagatgaatatttccaacaaaat
atggcggagataatgtcagcaataactccactctataaaaatcttttcacttatgtgcga
tcaaaactgattgaaagatacggtgatagaatacgcgaggatggacctttaccggcacat
gttttaggagatatgtggtctcaaaattgggaaggtttgttcgagttagtgcaaccattt
cctgcaagccgaaagctcgatgtaactttggatatgatgattcaaggtattactccaata
aggatgtttcaaatagcggaagaattttttacttcgctcggaatgaaaccgatgccaccg
gaattctggaaattttctatattagaaaaacctattgatagagaaattaaatgcactcct
agtgcgtgggatttttgtaatagaattgattacaggataaaacagtgtactagagtcaca
atggaagatttgttatctacccattatgaaatggcccatttgcaatattatttacaatac
aaggatcatccattgctattccgaaacgaagcaattccaggattccatgaagctgttagt
gatgccattggtttatccatttttactcgtcaacatttacataaaattgggctgcacaat
aatttaacggacaattatgatagtagcataaattttttaatgttaatggcacttcgcaaa
gtagcttatatgccgtttgcttatatagttgatcggtggagatggcgcgtatttagtgac
ggcgtggaagatatgacagcgcattggtgggaattaagattgcaatatcaaggcattgtt
ccacctgtacccagatttgaaaggaattttgatccagcagcgaaatatcacatcccagca
gacagtccttatgccaagtattttgtaagtactgtattacagtttcaactgttccaatct
ttgtgtgaaatttctggtcatattggcgaattgcacacttgcgatctttatagatcacga
gaagcaggtcgattactatcagatattctgtcaatgggagcttctagaccgtggcaagac
gttgttagacatatgacaagaagcaggacgaacagaatagacgctggtgccatgctcaaa
tattttgagcctttaaatgcatggttaaaacgacaaaatgagatgcaacctgtgatcggc
tggatcacaagtcgcgatgacagagaattattcgcacaatggtacgaaaacaatgcacga
agaattgaattgtggagtttatttcctctgcttgtaactgctaaaattattatttatatt
aataattatatattacatccagtgatttaa

DBGET integrated database retrieval system