KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105154058Help
Entry
105154058         CDS       T03917                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD1
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aec00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105154058
Enzymes [BR:aec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105154058
Chromosome and associated proteins [BR:aec03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105154058
   HMT complexes
    COMPASS/SET1 complex
     105154058
    COMPASS/SET1 complex (yeast)
     105154058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 DUF2572
Motif
Other DBs
NCBI-GeneID: 105154058
NCBI-ProteinID: XP_011067617
UniProt: F4X8N6
LinkDB All DBs
Position
Unknown
AA seq 1513 aa AA seqDB search
MNGMERHGHGHGHSHAHSHRHRHSHGSSQSSSQNSNQPSSKHSHSHVTHSQKDTAVPPAT
QKTQRNFKLLVDPFLVKGATRLCRYDGTVPGDPTYPQVQPRDPRSQLTRIWTRLEQLDLP
VPRFKIDSNYCGEPPPLEVTFCHLNDNIDKTFLTNMVQKFGSIEELTIYYHPLNNKHLGI
ARVVFESTKASKACVEKLNNTSVMGKVLRVFLDPFGEECKKMFEELTMEKKPPEKKVEKE
PSKPEPEPEKHQTPVEKALPEERDDFRNSKKPILNIEKNREPYVENSRYNKYRDYPTPSG
SAGSDLGYGTAPSELNYSSNYSQNSTPATNYDFYYSNYHHQPPSSYLTNISQNVSQNIPI
QQNSNVWWGNNSGSAAYSSSTSVWPIQPHATNLDNTGSNVTPINNKTSSAKAHTTPKKEK
ENQTTAKSTPRDSPDETRKTLDLDTRIAMLLKDKAGGMAPPFLQFGSDSEDDKKSQFGDN
EMLSDPPSPFLSHEIYKQCFDKIVERNKERRKVHENSISQFSVDEDLGSVISSSEDEALL
GSYSPAPDDNEPEPPKEPPPPPPPDDDRMSLSPLSSGDEKIEEVIAQTEPSNQLYPTTGY
PGHLTHYPSNDVYNWPRPTQYPYPYGTTYLQSHYQPNTASFSATMGNHQGANYYSSFQSR
LHAMANYNITKDPQGPTINGVLSRVVNELKQILKKDFNKKMIENTAFKLFEVWWDEKKSE
KNQIQGNSDNIIVNNTTKEDVKSQGLSSLLEQATPLGLNYDGFGLGIRASMPKMPSFRRK
IKAPSPLPQDEDSRQSGHADMETIESDSDLDIPPVQKTKKPMTSLPTISSSSTTSSSIES
SSEEISSSESSDSSNESSDEEACFEDEQDTDSRMSDNRPLACNSEDPDILMELAIQRSLD
CPTPTGRETPIPDIKIKDQNSNEFPQIDDDNLNSSLSSSIRYESIKEEERISETLPIVEE
KPFDVCRILDKEVKDTSKITEDKGTQSDMKPVIITSAIKEEVLPDIQKMENSAAEALMTL
AGHDNIIRHKSPGPIQSNIIRALQTMSAKYINDEPILKDNEKIEMFSEIPTTDSEEESLE
IRRLRYQAETELRLNGQRTPSSPGSQASQVYMEHSYSLPPAQPEPVEPVIRVPPASMKVK
HPKIVKLAKSKDNTHKIEKQKSKKYTKIHSNQNHVGEKENIRNDYIYDKLPKQVPEPTVT
YKERDLMSEMAILYEFLTRGIDSEDVEYLRRSYEALLADDTQGYWLNDTHWVDHSPTDVP
SPAKKRKRDELRLHASGSARTEGYYKVDIREKAKHKHHYAQSIQRSNDVEDSGGSYSGGD
GVMNGPKNNSKALTGKMQALSREARSNQRRLLTAFGIDTDSDLLKFNQLKFRKKQLKFAK
SGIHDWGLFAMEPIAADEMVIEYVGQMVRPVVADLREAQYEATGIGSSYLFRIDLDTIID
ATKCGNLARFINHSCNPNCYAKVITIESQKKIVIYSKQPIGVNEEITYDYKFPLEDDKIP
CLCGAPQCRGTLN
NT seq 4542 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcatggagagacatggtcatggacatggacattcacatgcgcattcgcatcgg
catcgccattcccatggcagttctcagagctcatcgcagaactcgaatcaaccgtcttca
aaacatagtcatagccacgtgacacattcgcagaaggatacggctgtgccaccagcgact
cagaagactcagagaaatttcaagctactggtcgatccatttttagttaaaggagctaca
agattatgtaggtatgatgggactgttccaggcgatccaacgtatccacaggttcaacct
cgagatcccagatcgcaattaactagaatctggactcgattggaacagcttgatctacct
gtacctagatttaaaattgattccaattactgtggagaacctcctccactagaggtaacg
ttttgccatttaaatgacaatattgataagacatttttaacaaacatggttcagaagttt
ggatctatagaagagcttactatttattaccatccgttaaacaataaacatcttggcata
gcaagagtggtgtttgaatcgaccaaggcttctaaagcatgtgtagaaaagttgaataat
acatctgtgatggggaaggtattaagggtttttctggatccctttggcgaagaatgtaag
aagatgtttgaggaattaactatggagaaaaaaccacctgaaaagaaggtggaaaaagag
ccatcgaagccagagccagagccagaaaaacatcagacaccagtggaaaaggctttaccc
gaggaaagggatgactttagaaatagtaaaaaacctattctaaatatagaaaagaacaga
gagccatacgtagaaaattcaagatacaacaagtatagagactatcctacgccgagtggc
agtgcaggtagtgatttgggttatggaacagcgcccagtgaattgaattattctagtaat
tattctcaaaattctactccagcaacaaattatgacttttactacagcaattatcatcat
caacctccgagtagctatttaactaatatctcacaaaatgtgtcacagaatatacctatt
caacagaactcgaatgtatggtggggtaataattctggatcagcagcatattcaagctca
acttccgtctggccaattcaaccacatgcaacaaatttggacaatactggttctaatgtc
acaccgattaataataaaacttccagtgcaaaagcgcataccactcctaaaaaggaaaag
gagaatcaaactacagcaaagagtacacctcgtgattctcctgatgaaactcgcaagaca
ttagatttagatacaagaattgctatgttactaaaggataaagcaggtggaatggcacct
cctttcttacagtttggcagtgactcagaagatgacaaaaaatctcaatttggtgacaat
gagatgttatcagacccacccagccctttcctctcacatgagatatacaaacagtgtttt
gataaaatagtagagagaaacaaagaacgaagaaaagttcatgaaaatagcattagtcag
ttttccgtggatgaggatttaggtagtgtcataagttccagtgaagatgaagcattgtta
ggaagttatagcccagcacctgatgacaatgaaccagagccacctaaggaaccacctcca
cctccaccgcctgacgacgacagaatgtctttgagtcctttaagttcaggagatgaaaaa
attgaggaagtaatagcacagactgaaccttcaaatcaactatatccgacaactggttat
ccaggacatttgactcactatccttctaatgatgtttataattggccacgaccgacacaa
tatccctatccttatggaacaacttacttacaaagccattatcaacctaacacagcgtct
ttttcggcaacaatgggaaatcatcaaggagcaaattattattcctcttttcaatctcgg
ttacatgctatggcaaattataatatcacaaaagatccacagggacctactatcaatgga
gtattaagcagagttgtaaatgaactaaaacaaattctaaagaaagattttaataagaag
atgatagagaacacagcattcaaattatttgaagtttggtgggacgaaaagaaatcagaa
aaaaatcaaattcagggtaacagtgataatattattgtcaataatacaacaaaagaagat
gtaaaatcgcagggattgtcatcattattggagcaagcaacaccactggggctcaattac
gatggttttggtttgggtattagagctagtatgccaaagatgccttcatttaggcgcaag
atcaaagctccaagcccattaccgcaggatgaggacagtcgacaatcgggtcatgctgat
atggaaacaattgaaagtgatagtgatctagatataccacctgtacaaaaaacaaaaaaa
ccgatgacttctctcccgactatttcttcctcgtctactacgtcttcgtcaatcgaaagt
agtagcgaggagattagttccagtgaatcttccgatagttcaaatgaaagttctgatgaa
gaagcttgctttgaggatgagcaagatacagatagccgaatgtccgacaataggcctttg
gcttgtaatagcgaagatcctgatattttgatggaacttgcgatccaaaggtctctagac
tgtcctacaccaactggcagagaaacgccgataccagatatcaaaattaaagatcaaaat
tcaaacgaattcccgcagattgatgatgacaatctgaatagttcattatcttcttctata
agatatgaaagcataaaagaagaggaaagaatttctgagacattacctatagtggaagaa
aaaccatttgatgtgtgtagaattttagacaaggaagtgaaagatacatcgaaaatcact
gaagataagggaacgcagagcgacatgaaaccggtaataataacatcagcaataaaggaa
gaggtgttaccggacatacaaaaaatggaaaattcggctgcggaagctctgatgactcta
gctggacacgataatattatacggcacaagagtccaggtcctatacaatctaatattatt
agagcgctacagacaatgtcagcaaaatacatcaatgacgaacctattttgaaggataat
gaaaagattgaaatgtttagtgagattcctacaactgactcagaggaagagagtttagaa
atcagaagactaaggtatcaagctgagacagaacttcgattgaatggacagcggacacca
agttcacctggttctcaggcttcgcaggtgtatatggaacattcgtattcgttaccacct
gcacaacctgagccggtggaaccggtgatacgagtaccaccagcctcgatgaaagtaaaa
catccaaagattgttaaattggcgaaatcgaaagataatactcataaaatcgagaaacag
aaatccaagaaatatacaaaaatacacagcaatcagaatcatgtgggagagaaggaaaat
atccgaaatgattatatatatgataagcttcctaaacaggttccagaaccgactgtcacg
tacaaagaacgagatcttatgtcagaaatggctattttgtatgaatttttaactagggga
atagactcggaggatgtagaatatttgagaagaagttacgaggctttattagcggacgac
actcaaggttactggttgaacgatacgcactgggttgatcattcgccgacggatgtacca
agccccgcgaaaaaaaggaaacgagacgaactccgattgcatgcgagtggaagtgctaga
acggaaggatattacaaagttgacatcagggagaaggctaaacataaacatcattatgct
caaagtatacagcgcagtaatgatgtggaggacagcggcggctcttacagtggaggtgat
ggtgtaatgaatggtccaaaaaataattctaaagcgttgactggtaaaatgcaagcattg
tcacgcgaggcacgaagtaatcaacgccgactattaacagcttttggaattgatacagac
agtgatctccttaagtttaatcaattaaagttccgtaaaaagcaattgaagtttgctaaa
tctggtattcacgattggggcttgttcgccatggaaccaatcgcggccgatgaaatggtt
atcgaatatgttggacaaatggttagaccggttgtagccgatctacgagaagctcaatac
gaagccactggaattggaagttcttacctcttccgcatcgatttagatacaattatcgat
gcgacgaaatgcggcaatttggcgaggtttataaatcacagttgtaatccgaattgttac
gcaaaagtaatcacgatcgaaagccaaaagaagatcgtaatctacagtaaacaaccgata
ggagttaatgaagaaattacttatgattataaattcccattggaggatgacaaaatccct
tgcctttgcggagctcctcaatgccgtggtaccctcaactga

DBGET integrated database retrieval system