KEGG   Alkalilimnicola ehrlichii: Mlg_0261Help
Entry
Mlg_0261          CDS       T00391                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aeh  Alkalilimnicola ehrlichii
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aeh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mlg_0261
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mlg_0261
   00680 Methane metabolism
    Mlg_0261
Enzymes [BR:aeh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mlg_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(292878..295526)
Genome map
AA seq 882 aa AA seqDB search
MSIQDSDAALRDDIRLLGEMLGDTLKEQEGTDLFDTVERIRALAKQARAGDQGAAEALEQ
ELGSLDEHQIMPVARAFSQFLNLANIAEQHHRVRRSREWARSPDASPLKGSLAEAFPRLL
QGETDPEALYHAACELDIELVLTAHPTETQRRTMLQKYNRIARLLDGRDRLDLTPDETEE
VTAGLRREIIGAWQSDEIRRRRPTPVDEARWGLAVMEQVLWDAVPRYLRNLDRSLREHTG
RALPLDAAPIRFGSWMGGDRDGNPNVTARVTREVCLAGRWMAATLYEKEIQTLINTLSMT
RCDQALRELVGDAWEPYRVLLKRLRARLRLTQRWVEARLAGKRPPEGEVLLDKEDLLRPL
LTCYHSLHRCGAGQVAEGELLDTIRRVSCFGLTLTRLDIRQHADRHADALSEITSALGLG
RYDQWDEEARQRWLLSELASRRPLIPDDLEPGEEAAEVLETCRTLAELGSDGLGAYIISM
AEHPSDILAVELLQKACGVTQPLRSVPLFETRDTLQNAAETMRVLFEQPWYRDRIGGHQE
IMIGYSDSGKDAGHLTAAWTLYQAQEALVALAEENGIQLTLFHGRGGSIGRGGGPTHAAV
LSLPPGSVKGTLRVTEQGEVIQSKFGLPGIALRNLEIYTAAVLEATLQPPAEPRPEWREV
MDRLSDTACGAYRGLVKETPEFIEYFQAATPVREIGQLAIGSRPAKRNQKALTVDNLRAI
PWIFAWTQTRLMLPAWLGVGDALSEALEEDLGDTLREMFQQWPFFEAFLDMVEMVLAKGD
PGVASLYDRRLVPEELHGMGEQLRGRYRKTLDAVLSVTGHERPLADFPVVRRAVDVRNPY
VDPLNLLQAELLYRSRLCDDEQLRRVLMVAINGIAAGMRNTG
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcaggattccgatgccgccctgcgcgacgacattcgcctactcggcgagatg
ctgggcgacaccctgaaggagcaggagggcacggatctcttcgacaccgtggagcgcatc
cgcgccctggccaaacaggcgcgcgccggggatcagggcgccgccgaggccctcgagcag
gagctgggctcgctggatgagcaccagatcatgcccgtcgcccgcgccttctcgcagttc
ctcaacctggccaacatcgccgaacagcaccatcgcgtccggcgcagccgcgagtgggcg
cgcagcccggacgccagcccgctcaagggctcgctggccgaggccttcccccgcctgctg
cagggcgagaccgaccccgaggccctctaccacgccgcctgcgagctggacatcgagctg
gtcctcaccgcccaccccaccgagacccagcgccgtaccatgctgcagaagtacaaccgc
atcgcccggctgctggacggccgcgaccggttggacctgacccccgacgaaaccgaggag
gtcaccgccggcctgcgccgggagatcatcggtgcctggcagagcgacgagatccgccgc
cgccggcccacgccggtggacgaggcgcgctggggcctggcggtaatggaacaagtgctc
tgggacgccgtcccccgttatctgcgcaacctcgaccgcagtctgcgcgagcacaccgga
cgcgccctgccgctggacgccgcccccatccgcttcggctcctggatgggcggtgaccga
gacggcaatcccaacgtcaccgcccgggtcacccgggaggtctgcctggccggccgctgg
atggccgccaccctgtacgaaaaggaaatccagaccctcatcaacaccctgtccatgacc
cgctgtgaccaggccctgcgcgagctggtgggcgacgcctgggagccctaccgggtgctg
ctcaaacgcctgcgggcccggttgcgcctgacccagcgctgggtggaagcccgcctggcc
ggcaagcgcccgcccgagggcgaagtgctactggacaaggaggacctactgcggccgctg
ctgacctgctaccactcgctccaccgctgcggcgctggccaggtggccgagggcgagttg
ctggacactattcgccgggtctcctgcttcggcctcaccctcacccggctcgacatccgc
cagcacgccgaccgccacgccgacgccctctccgagatcaccagcgccctgggcctgggc
cgctacgaccagtgggacgaggaggcccgtcagcgctggctattgagcgagctggccagc
cgccggccgctgatcccggacgacctggaaccgggcgaggaggccgccgaggtcctcgag
acctgccgcaccctggccgagctgggcagcgacggcctgggcgcctacatcatttccatg
gccgaacacccctccgacatcctcgcggtggagctgctgcaaaaggcctgcggtgtcacc
caaccgctgcgcagcgtcccgctgttcgagacccgggacaccctgcagaacgccgccgag
accatgcgggtactgttcgaacagccctggtatcgcgaccggatcggcggccaccaggag
atcatgatcggctactccgactcgggcaaggatgccgggcacctcaccgctgcctggacc
ctctaccaggcccaggaggccctggtggccctggccgaggaaaacggcatccaactcact
ctgttccacggccggggcggttccatcggccgcggcggcggtcccacccacgccgccgtg
ctctcactgccgcccggttcggtcaagggcaccctgcgggtcaccgaacagggcgaagtc
atccagtccaagttcggcctgcccggcatcgccctgcgcaacctcgagatctacaccgcc
gcggtgctggaggccaccctgcagccgccggccgaaccgcggcccgaatggcgcgaggtg
atggaccggctcagcgacaccgcctgcggggcctaccgcgggctggtcaaggagacacca
gagttcatcgagtacttccaggccgccaccccggtgcgcgagatcggccagctggccatc
ggcagccgtccggccaagcgcaaccagaaggcgctcaccgtcgacaacctgcgggccatc
ccctggatcttcgcctggacccagacccgcctgatgctgcccgcctggctgggcgtgggc
gatgcgctgagcgaggcgctggaggaggacctaggcgacaccctgcgggagatgttccag
cagtggcccttcttcgaggccttcctggacatggtggagatggtcctggccaagggcgac
ccgggcgtggccagcctctacgaccgccgcctggtgccggaagagctccacggcatgggc
gagcagctgcgcgggcgctaccgcaagaccctggacgccgtgcttagcgtcaccgggcac
gaacggccgctggccgacttcccggtagtccgccgcgcggtggacgtgcgcaacccctac
gtggacccgctcaacctgctgcaggccgagctgctctaccgcagccgcctgtgcgacgat
gaacagctccgccgcgtgctcatggtggccatcaacggcatcgccgccggcatgcgcaac
accgggtag

DBGET integrated database retrieval system