KEGG   Aeromonas sp. O23A: O23A_p4492Help
Entry
O23A_p4492        CDS       T04990                                 

Definition
(GenBank) Alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
aeo  Aeromonas sp. O23A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aeo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    O23A_p4492
Enzymes [BR:aeo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     O23A_p4492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4741874..4744138)
Genome map
AA seq 754 aa AA seqDB search
MHNTLFRTAMLAAVLSSFSHTTAAEGVMVHLFQWKFNDIANECENVLGPKGFGSVQITPP
AEHKQGSQVWWTVYQPVSFKNFNSFGGNEAELKSMIARCNAAGVKIYADAVFNQLASGTG
TATGGGSYNSGQYQYPQFGYNDFHHSGDITNYGDSNNVWNGALYGMPDLKTESPYVQDQI
ATYMKTLLGWGVSGFRVDAAKHMAPADVKAILVKAGSPKAYLEVIGAGGESAEIQPNRYT
HIDTVTEFKYGTDLAANFNGKIKNLKTLGESWGLLPSDKSFIFVVNHDRERGHGGGGMLT
FMNGARYELANVFMMAWPYGWKQVMSGYRFENMGTYETDKGAPGSTPCSDTQWNCEQRRP
QIMNMAMFHNQTKDLPVNNWWDNGNNQIAFGRGDKGFVAINNESGNLVASVQTGLPAGEY
CNILSGNDYCSGAYIKVDGSGKASLNLVGMKAAAILVGCTKAAPCGGVIPGNRFSSLNLR
GTHNAWGNTAMQVDANRIWSAIINFTGAGDTSGAQRFKFDVFGNWTENYGDNEGDGIADK
GSTRDIYFNGAGQYRIALKESDLSYTVTALNNNQAPVAVISPKNPSVKLGESLVFDASGS
ADDAGVASYSWSTGGSGKTETVQFDTLGSRTVTVTVTDTEGLTASASATVNVTDGSDAYT
SELPTLHFRGTPNGWGVLAMTLVADNQWEARVTFDGQTNQRFKFDVKGDWSQNYGDTNKD
GVAELTGADITTPVVGAYVVRFNDQTLTYSLNAQ
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacacactgtttcgaactgccatgctcgctgcggtgctgagctcattcagccac
acaaccgccgccgaaggcgtcatggttcacctgttccaatggaagttcaacgacatcgcc
aacgagtgcgagaatgtcctcggccccaagggattcggaagcgttcagatcacgccacct
gccgagcacaagcaaggaagtcaggtctggtggaccgtctaccagcccgtcagcttcaag
aacttcaacagcttcggcggcaacgaggcggagctcaagagcatgatcgcccgctgtaac
gccgccggggtcaagatctacgccgatgccgtcttcaaccagctggcatcgggcacggga
accgccaccggcggcggcagctacaactcggggcaatatcagtatccccagttcggctac
aacgacttccaccatagcggtgacatcaccaactacggcgacagcaacaacgtctggaat
ggcgcgctctacgggatgccggacctgaaaaccgagtcgccctatgtgcaggatcagatt
gccacctatatgaagaccctgctcggttggggagtttcgggttttcgggttgacgcggcc
aaacacatggcccctgccgatgtgaaggccatcctcgtcaaggccggctccccaaaagcc
tatctggaagtgatcggtgcaggtggtgaatccgccgagatccagcccaatcgctacacc
catatcgacacagtcaccgagttcaagtacggcaccgatcttgctgccaacttcaacggc
aagatcaagaatctcaagaccctgggagagagctggggcctgctcccttccgacaagtcc
ttcatcttcgtggtcaaccacgaccgcgagcgcggtcacggtggcggcggcatgctcact
tttatgaacggtgcccgctatgagctggccaacgtcttcatgatggcctggccctatggc
tggaagcaggtaatgtcgggatatcgcttcgagaacatgggtacctacgaaaccgacaag
ggcgcccctggcagcacaccttgctccgatacccagtggaactgtgaacaacgccgtcca
cagatcatgaacatggccatgttccacaaccagaccaaggatctgccggtcaacaactgg
tgggataacggcaacaaccagattgccttcggtcggggtgacaaaggtttcgtcgccatc
aacaacgaaagcggcaacctagtggcctcggtccagaccggactgccagctggcgagtac
tgcaacatcctgagtggcaatgattactgcagcggcgcctacatcaaggtcgacggcagc
ggcaaggccagcctgaacctcgtcggcatgaaggccgccgccatactggtcggctgtacc
aaggcagccccttgcggtggcgtcattccgggtaaccgattcagcagcctgaacctgcgc
ggtacccataatgcctggggcaacacggcaatgcaggtggatgccaaccgcatctggtca
gccatcatcaacttcaccggcgccggtgataccagcggtgcccagcgcttcaagttcgat
gtgtttggcaactggaccgagaactacggtgacaacgaaggggacggcattgccgacaag
ggcagcaccagggatatctacttcaatggtgcaggtcagtatcgcatcgccctcaaggag
agcgatctcagctacacggtcactgcgttgaacaacaaccaggcgccagttgcggtcatc
tcgcccaaaaaccccagcgtcaagctgggtgagagcctggtgtttgacgcctcaggctcc
gccgatgatgccggtgttgcgagttacagctggtccaccggtggcagcggcaagacagag
actgtccagttcgataccctgggttcccgcacagtgacagtcactgtcaccgatacagaa
gggctgacagccagtgccagcgcgacagtgaacgtgaccgacggcagtgacgcctacacc
agcgagctgccgaccctgcactttcgcggtaccccgaacggctggggtgttcttgccatg
accctggtcgccgacaatcagtgggaagcacgagtcaccttcgatggccagaccaaccag
cgcttcaagttcgatgtaaagggcgactggagccagaactacggggataccaacaaggat
ggcgtcgccgagctgaccggtgccgacatcactaccccggtggtgggagcctatgtggtc
cgcttcaacgatcaaaccctgacctacagcctgaacgcccagtaa

DBGET integrated database retrieval system