KEGG   Alistipes finegoldii: Alfi_1240Help
Entry
Alfi_1240         CDS       T02133                                 

Definition
(GenBank) alpha-amylase/alpha-mannosidase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
afd  Alistipes finegoldii
Pathway
afd00500  Starch and sucrose metabolism
afd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Alfi_1240
Enzymes [BR:afd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Alfi_1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 DUF4466
Motif
Other DBs
NCBI-ProteinID: AFL77588
UniProt: I3YKS0
LinkDB All DBs
Position
1360005..1361219
Genome map
AA seq 404 aa AA seqDB search
MKTVCLYFQVHQPWRLKKYRFFNMGKDHNYLDDLLNRSIMQKVARQCYLPMNALLLKLIK
ENKGKFRCSFSITGIAVEQFRAFAPEVLDSFKELAATGCVEFLAETYSHSLASLASKEDF
TEQVKLHTAMIKKEFGVKPTAFRNTELIYSDEIGAMVADMGFRTMLAEGAKHVLGWKSPN
YVYANAINQKLRLLLRNYKLSDDIAFRFSNRSWDEWPLTADKYVKWLSSDETPGEVINLF
MDYETFGEHQTADTGIFEFMRALPKAILAKKNDMEFATVSEAAKKYQPVSVLHCPHVMSW
ADEERDVTAWLGNELQNEAFSKLYAQKEKVAALKSPDFDYVWSFMQTSDHFYYMATKWLS
DGDVHSYFNPYDSAYDAFINYMNVLSDFIIELDQAVAAKAAKAK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgtctgcttatattttcaggtacaccagccttggcgactgaagaagtaccgc
ttcttcaacatgggcaaggaccacaactacctagacgacctcctgaaccgctcgatcatg
cagaaagtcgcccggcagtgttacctgcccatgaacgccctgctgctgaagttgatcaag
gagaacaagggtaaattccgctgttcgttctcgatcacgggcatcgccgtcgagcagttc
cgcgccttcgcgcctgaggtgctcgactcgttcaaggagctggccgccacgggatgcgtc
gagtttctggccgaaacctactcccattcgctggcatcgctggcgtcgaaagaggatttc
accgaacaggtgaagctccatacggcgatgatcaagaaggaattcggcgtgaagcccacc
gccttccgcaacaccgagctgatctactccgacgagatcggcgccatggtcgccgacatg
ggcttccgcacgatgctggccgaaggcgccaagcacgtgctgggctggaaatcgcctaac
tacgtctatgccaacgccatcaatcagaaactgcgcctgctgctgcgcaactacaagctc
tcggacgacattgcgttccgtttctcgaaccgcagctgggacgaatggccgctgacggcg
gacaaatacgtcaaatggctctcttcggacgaaacgccgggcgaggtcatcaacctcttc
atggactacgagacgttcggggagcatcagacggcggatacgggaatcttcgaattcatg
cgggcgctccccaaagcgatcctcgccaagaagaacgacatggagttcgccaccgtaagc
gaggccgccaagaagtaccagccggtgtccgtactccactgtccgcacgtaatgtcgtgg
gccgacgaggagcgcgacgtgacggcgtggctcggcaacgagttgcagaatgaggctttc
tcgaaactctacgcccagaaagagaaggtcgccgccctgaaaagccccgatttcgactat
gtatggagtttcatgcagacctcggaccacttctactacatggcgaccaaatggctctcg
gacggcgacgtacactcctacttcaacccgtacgactcggcatacgacgccttcatcaac
tacatgaacgtcctttcggacttcatcatcgagctggatcaagcggtggccgccaaagcc
gccaaggcaaaataa

DBGET integrated database retrieval system