KEGG   Alistipes finegoldii: Alfi_2042Help
Entry
Alfi_2042         CDS       T02133                                 

Definition
(GenBank) translation elongation factor TU
  KO
K02358  elongation factor Tu
Organism
afd  Alistipes finegoldii
Brite
Translation factors [BR:afd03012]
 Eukaryotic Type
  Elongation factors
   Alfi_2042
 Prokaryotic Type
   Alfi_2042
Mitochondrial biogenesis [BR:afd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Alfi_2042
Exosome [BR:afd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Alfi_2042
  Exosomal proteins of breast cancer cells
   Alfi_2042
  Exosomal proteins of colorectal cancer cells
   Alfi_2042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AFL78346
UniProt: I3YMX8
LinkDB All DBs
Position
2292011..2293198
Genome map
AA seq 395 aa AA seqDB search
MAKEKFDRSKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGLSELRSFDSIDNAPEEKERG
ITINTSHVEYQTANRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTNEHV
LLARQVNVPRIVVFLNKCDMVDDPEMLDLVEMEVRDLLSKYEYDGDNAPVIRGSALGGLN
GEPAWEDKIMELMNAVDEYIPIPQRENEKPFLMPVEDVFSITGRGTVVTGRIETGIIHVG
DPVEIVGLEEKTLTSTCTGVEMFRKLLDEGEAGDNVGLLLRGIDKKEVKRGMVVAKPGSI
TPHTEFEAEVYILKKEEGGRHTPFHNNYRPQFYLRTMDVTGEVHLPAGVDMVMPGDHVTI
TVKLIYPVAINEGLRFAIREGGRTVGAGQILKIVK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaattcgaccgttcgaaaccgcatgtgaacatcggtaccatcggacac
gttgaccacggtaagaccacccttaccgctgctatcacgaccgttctggctaagaaaggt
ctgtcggagcttcgttcgttcgactccatcgacaacgctcctgaggagaaagagcgtggt
atcacgatcaacacctcgcacgttgagtaccagacggccaaccgccactatgctcacgta
gactgccccggacacgccgactatgtgaagaacatggttaccggtgccgctcagatggac
ggtgccattctggtagttgccgcaacggacggcccgatgccccagaccaacgagcacgtg
ctgctcgcccgtcaggtgaacgttccccgcatcgttgttttcttgaacaagtgcgacatg
gtggacgaccccgaaatgctcgacctcgtcgagatggaggttcgcgacctgctttcgaaa
tacgaatatgacggcgacaacgctcccgttatccgcggttccgcactcggcggcctgaac
ggcgagccggcatgggaggacaagatcatggagctgatgaacgctgttgacgagtatatt
ccgatcccgcagcgtgagaacgagaagccgttcctgatgcctgtcgaggacgtgttctcg
atcaccggccgcggtaccgttgtaacgggccgtatcgagaccggtatcatccacgtaggc
gatcccgtcgagatcgtaggtcttgaggagaagaccctgacttcgacctgtacgggcgtc
gagatgttccgcaagctgctcgacgagggcgaggccggcgacaacgtaggtctgctgctc
cgcggtatcgacaagaaagaggttaagcgcggtatggtagtcgctaaacccggctcgatc
accccgcacaccgagttcgaggctgaggtctacatcctgaagaaggaagagggtggccgt
cacacgccgttccacaacaactatcgtccccagttctatctgcgtacgatggacgtgacc
ggtgaggttcacctgcccgcaggcgtagacatggttatgcccggcgaccacgtgaccatc
accgtgaagctgatctacccggtagctatcaacgaaggtctgcgtttcgcaatccgcgag
ggtggccgtacggtaggtgcaggtcagatcctgaagatcgtgaaataa

DBGET integrated database retrieval system