KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_1389Help
Entry
Lferr_1389        CDS       T00758                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:afe00001]
   00630 Glyoxylate and dicarboxylate metabolism
    Lferr_1389
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Lferr_1389
Enzymes [BR:afe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Lferr_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1344477..1345898)
Genome map
AA seq 473 aa AA seqDB search
MAVKKYEAGVKEYRQTYWAPEYVPLDSDILACFKITPQPGVDREEAAAAVAAESSTGTWT
TVWTDLLTDMDYYKGRAYRIEDVPGDDTSFYAFIAYPIDLFEEGSVVNVFTSLVGNVFGF
KAVRALRLEDVRFPLAYVKTCNGPPHGIQVERDKMNKYGRPMLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFVADAIHTAEAETGERKGHYLNVTAPSP
EEMYERAEFAKELNMPIIMHDFLTGGFCANTGLARWCRKTGTLLHIHRAMHAVVDRNPHH
GIHFRVLVKALRLSGGDHLHTGTVVGKLEGDRASTQGWVDLLRESFVPEDRSRGIFFDQD
WGSMPGVFAVASGGIHVWHMPSLLAIFGDDAVFQFGGGTLGHPWGNAAGAAANRVALEAC
VEARNEGRDLEREGKDILTNAAKDSPELKIALETWKEIKFEFDTVDKLDVVNR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaaaaaagtatgaggccggagtaaaggaataccggcagacctattgggccccc
gagtacgtgcctttggactctgatatcttagcctgtttcaaaattacgccacaaccaggg
gtggatcgtgaagaagccgccgccgcggtagccgccgagtcttctaccggcacctggacc
acggtgtggaccgatttgctgactgacatggattactacaaaggccgtgcttatcgcatc
gaagatgtgccgggcgatgacaccagcttttacgcatttatcgcctatcccatagatttg
ttcgaagaagggtccgtggttaacgtattcacctctttggtgggtaatgtcttcggcttc
aaggcagtgcgtgcactacgcctggaagatgtacgcttcccactcgcctacgtcaaaacc
tgcaacggaccgccccacggcatccaggtcgagcgcgacaagatgaataaatatggccga
ccaatgctcggctgcaccatcaagcccaagcttggtctatctgcaaagaattatggtcgt
gcagtctacgagtgtctgcgcggcggtctggatttcaccaaggacgatgagaacgtcaac
tcgcaacccttcatgcgctggcgcgatcggtttctgttcgtggctgatgcgatccacacg
gccgaagctgaaactggtgagcgcaaaggacactatttaaatgttacagcaccctcgccc
gaggaaatgtatgagcgggcagagttcgccaaggaactcaatatgcccatcatcatgcac
gacttccttacgggtggtttctgtgccaataccggtctggcgcgttggtgccggaaaacc
ggcaccctgctacacatccaccgtgccatgcatgcggttgtggaccgtaatccgcaccac
ggcattcactttcgggtgctcgtcaaggcgcttcgtctgtcgggtggtgatcacctgcat
acaggcacggtggttggcaaactggaaggtgaccgcgcctccactcaagggtgggtcgac
ctgctacgcgaatcgttcgtccctgaggatcgcagtcgaggcatcttcttcgaccaggac
tggggatccatgccaggtgtgttcgcagtagcctctggcggtatccacgtctggcacatg
ccgtcgttgttagcaatctttggcgatgatgcggtattccagtttggtggcgggacgcta
gggcacccatggggcaacgctgccggagcagctgccaatcgtgtcgcgctagaggcgtgt
gtggaagcgcgcaatgaaggtcgcgatctcgagcgcgagggcaaggacattctcaccaac
gcagcgaaagacagtccagagttaaaaattgctctggaaacctggaaagagatcaagttt
gaatttgataccgtggacaaattggacgtggtgaatcgctga

DBGET integrated database retrieval system