KEGG   Archaeoglobus fulgidus DSM 8774: AFULGI_00017370Help
Entry
AFULGI_00017370   CDS       T03231                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase, archaeal type
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
afg  Archaeoglobus fulgidus DSM 8774
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:afg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFULGI_00017370
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AFULGI_00017370
   00680 Methane metabolism
    AFULGI_00017370
Enzymes [BR:afg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AFULGI_00017370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1502240..1503655)
Genome map
AA seq 471 aa AA seqDB search
MVPRVMSTQHPDNARIPFFAASEVLNGEDEVREAYYVFSHFKCDEQMWDFEGKEADAHIV
RKLLSSYYDFFSSRPLGKDFRLTMRVPNPEIEKGEAKLLAETLEMIPRSYDYVRSLGIEH
PPIFEVILPMTRSAEEVMKVHAFYRDFVAGKGRFELLGEKVSDWLGDFLPEEIKVIPLFE
DRDSLMRAAEISERYAEWAELDELRVFLARSDPAMNYGFVAATIYVKKALYDLSQLGIST
YPILGVGSCPFRGGFSPKNLSVLDEFPSVYTFTVQSAFKYDYEFGDVRRAIKRAKEAARR
KSDYVDEEHLQVAEKLKDGYRRRIAKIAEIVNRISSRIPRRRMRKLHVGLFGYSRGEEIK
LPRAITFCASLYSIGLPSEIIGIAEMSDKDYEAVCEVFKNFDGMMESAMSLFNPESLKIV
DLSMDFERAKELFGYEPDERHLEKTNEIIKQIDGDIKNLVVEAGILRGFLG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggttccgagggtgatgagcacgcagcacccagacaacgccagaattcccttcttcgca
gcatctgaggtgttgaacggcgaggatgaggtaagagaggcttactacgttttttctcac
tttaagtgcgacgagcagatgtgggacttcgaggggaaggaggcagatgcacacattgtg
agaaaacttctttccagctactacgactttttcagctccagaccacttggcaaagatttc
aggctcacgatgagagttcctaatcccgagattgagaagggagaagccaagcttcttgca
gaaactctcgaaatgattcctcgcagttacgactacgtcagaagcttggggatcgagcat
ccacctattttcgaggttattttgccgatgacgagaagtgctgaggaggttatgaaggtt
cacgccttttacagagattttgttgcaggtaagggtcgatttgagctgttgggtgagaaa
gtttcagactggctgggggattttttgccggaggagataaaagtcattccgctctttgaa
gacagggattcgctgatgagagcagcagaaatatcggagaggtatgcagagtgggctgag
cttgacgagctcagagtttttcttgcgaggtcggacccggcaatgaactatggatttgtt
gctgcgacaatctacgtcaaaaaggctctttacgacctttcacagctcgggatttccacg
tatcctattttgggtgttggctcgtgtcccttcaggggagggttttctccgaagaacctg
agtgtgctggatgaattcccgtccgtttacaccttcaccgtccaatctgcctttaaatac
gactacgagtttggggacgtgagaagggcgataaagagggctaaggaagcagcaaggagg
aagtcagactatgttgacgaggaacaccttcaggtggccgaaaagctgaaagatggttac
agaagaagaatcgccaagattgcggaaatcgtcaacaggatttcttccagaattccgaga
aggagaatgagaaagcttcacgttggccttttcggatattcaaggggagaggaaattaag
ttgccaagagccataaccttctgcgcgagcctttactccatcggcctgccgtctgagata
atcggaattgcggagatgagcgacaaggattacgaagcagtatgcgaggtcttcaagaac
ttcgacggaatgatggaatccgcaatgagccttttcaatcctgagagcctgaaaattgtt
gacctctcgatggactttgagagagcaaaggagcttttcggctatgagcctgatgaaaga
catctggaaaagacaaacgagataataaagcaaattgatggagatattaagaatctggtt
gtcgaggcagggattttgagaggatttctgggatag

DBGET integrated database retrieval system