KEGG   Archaeoglobus fulgidus DSM 8774: AFULGI_00025790Help
Entry
AFULGI_00025790   CDS       T03231                                 

Definition
(GenBank) Aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
afg  Archaeoglobus fulgidus DSM 8774
Pathway
afg00030  Pentose phosphate pathway
afg01100  Metabolic pathways
afg01120  Microbial metabolism in diverse environments
afg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:afg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AFULGI_00025790
Enzymes [BR:afg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     AFULGI_00025790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AIG99291
UniProt: A0A075WH21
LinkDB All DBs
Position
2216237..2218078
Genome map
AA seq 613 aa AA seqDB search
MAGGYMGKILKVNLSEGSIKELPIDEEIARKYLGGKGYAVRLLYDYLTEYERLGIAPEDI
DPLGEENVLIFATGPATGVIGFPEPGRYHVMTLRSPLTGGIGSANSGGRFGPYMKFAGYD
MIIVEGKSEEPVYLEVIDGSAEIKCAKDLWGKNTFDTTRILTKRAGGNCSVACIGPAGEN
LVHIACIINEEHRAAGRTGVGAVMGSKKLKAIVVKGSERPEIAKPDEFKAASKEMLDKIK
QNPVTGEGLPKYGTAVLVNVINNAGALPYKNWQEAYNEKADEISGETLEAKYLRKRVACW
GCSIGCGRATEVKTGPFKVLNTEGPEYESIWALGNDTAVINLEAVIKANHFCDELGIDTI
SMGSTIACAMELYEKGYIKDEDLQGLDLSFGSDAAMVEAVWRTAYKTGIGKYLALGSKRL
AEIFGAPELSMSVKGLEMPAYDPRGIKGIGLNYATANRGGCHVTGYTVSPEIVGLPEKID
PLTYEGKAAWVKAFQDFTCVVNSAVNCLFTTFALGAEDYAVLLSHITGWDLNADEIMKIG
ERIYNLERVILNKYGFDGKDDTLPKRLLTEPLKEGPAKGQVVELDRMKEEYYQLRGWENG
VPTKEKLKELDIP
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaggttatatgggcaaaattttgaaggtgaatttgagcgaggggagcataaag
gagctcccgattgatgaggaaatagccagaaaataccttggcgggaagggatatgcagta
agacttctttacgactacctcaccgagtacgagaggctcggaatcgccccagaggacatc
gacccgctcggggaggagaacgttctgattttcgctactggccctgcgacgggtgttata
ggctttccagaaccgggaaggtaccacgtcatgactctcagaagcccgctaaccggaggg
attggctccgcaaacagcggtggcagatttggaccgtacatgaagtttgcgggctacgac
atgattattgtggagggcaaaagcgaggagcccgtttacctcgaggtaattgatggttct
gcagagataaagtgcgcaaaggacctttggggcaaaaacaccttcgacaccacgagaatt
ctcacaaagagagctggaggaaactgcagcgtcgcatgcatcggtcccgcgggagagaat
ctagtccatattgcctgcataataaacgaagagcacagagctgcagggagaacgggagtt
ggagccgttatgggctcgaagaagctaaaggcgatcgtcgtcaaaggctcggagaggccg
gaaatagccaagcccgacgagttcaaggctgcatcaaaggaaatgctggacaagatcaag
cagaacccggtaacgggagagggtctgccgaagtacggaacagcggtgctggttaacgtg
ataaacaacgccggagcgttgccctacaagaactggcaggaggcgtacaacgagaaggcg
gatgaaatcagcggagaaacactggaggcgaagtacctgaggaagagggtcgcatgctgg
ggctgcagcatagggtgcggaagggcgacggaggttaagaccggtccgttcaaggtcctc
aacactgaagggcctgagtacgagtcaatttgggctctcggtaacgatactgcagtgata
aaccttgaggcggttatcaaggccaaccacttctgcgacgagcttggcatagacacaatc
tcaatgggttcaacaattgcctgtgcgatggagctttacgagaagggctacataaaggac
gaggaccttcagggactcgatttgtccttcggcagcgatgcggcgatggttgaggctgtg
tggagaactgcgtacaagactggtatagggaagtacctggctttgggcagcaaaaggttg
gcagagatcttcggcgcacctgagctttcgatgagcgttaagggacttgagatgcctgcc
tacgacccaagaggcataaagggcataggactgaactacgcaaccgcaaacagaggaggt
tgccacgttaccggctacacggtctcgccggaaattgtggggctgcctgagaaaatcgac
ccactcacctacgaaggaaaggccgcatgggttaaggccttccaggacttcacctgtgtg
gtgaactccgcggtgaactgcctcttcacgaccttcgctctcggtgcagaggactatgcg
gtgctgctctcccacatcacaggatgggatttgaacgctgacgagataatgaaaattgga
gagagaatttacaacctcgagagagttatactcaacaagtacggcttcgacggcaaggat
gacacacttccgaagcgcttgctaaccgaaccgcttaaggaggggccagccaagggacag
gtcgttgagctggacaggatgaaggaggagtactatcagctaagaggctgggagaacgga
gttccgacaaaagagaaattgaaggagctggacatcccctaa

DBGET integrated database retrieval system