KEGG   Acidithiobacillus ferrivorans: Acife_0185Help
Entry
Acife_0185        CDS       T01595                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
afi  Acidithiobacillus ferrivorans
Pathway
afi00010  Glycolysis / Gluconeogenesis
afi00230  Purine metabolism
afi00620  Pyruvate metabolism
afi01100  Metabolic pathways
afi01110  Biosynthesis of secondary metabolites
afi01120  Microbial metabolism in diverse environments
afi01130  Biosynthesis of antibiotics
afi01200  Carbon metabolism
afi01230  Biosynthesis of amino acids
Module
afi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
afi_M00002  Glycolysis, core module involving three-carbon compounds
afi_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
afi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:afi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acife_0185
   00620 Pyruvate metabolism
    Acife_0185
  Nucleotide metabolism
   00230 Purine metabolism
    Acife_0185
Enzymes [BR:afi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Acife_0185
Membrane trafficking [BR:afi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Acife_0185
Exosome [BR:afi04147]
 Exosomal proteins
  Proteins found in most exosomes
   Acife_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI IMPDH
Motif
Other DBs
NCBI-ProteinID: AEM46420
JGI: Acife_0185
UniProt: G0JQX6
LinkDB All DBs
Position
complement(197340..198779)
Genome map
AA seq 479 aa AA seqDB search
MIRRTKIVATLGPASSDVQVIDRLIEAGVDVVRLNFSHGTAEEHIQRADMVRERARAHGR
AIGVLADLQGPKIRIGKFAEGKIHLKEGEPFILDTTCALGDQTRVGVTYPQLVGDVDRGA
TLLLNDGMIVLWVEKVQGHEIHTRVVQGGELSNNKGINRAGGGLTAPALTDKDRADIITA
ARLEADYLAVSFPRSAADMDEARRLFREAGGHGAMVAKIERAEAVEAIEEILAVSEVIMV
ARGDLGVEIGDAAVPPVQKRIIALAQKYNRLTITATQMMESMIHQPIPTRAEVSDVANAV
LDGTDAVMLSAETASGAFPVEAVAAMDRTCREVERQAPINNTLPILDRPLERMDETIAAA
AILATMRSPIVAIAAFTESGSTALWLSRANPRVPIYALTPQVYTRRKVTLYRGVHPVNFP
QSRHDDPVQVMRAAEDELRRRGVVRNGDLILITIGEPMGASGGTNTLKLVRVGDVTHRA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
ttgatacgccggacgaaaatcgtcgcaaccctgggtcctgccagttccgatgtgcaggtc
atcgatcgcctgatcgaggcgggcgtcgatgtcgtccgcctcaatttctcccacggcacg
gcggaagagcatatccagcgtgccgatatggtgcgggaaagggcgcgcgcccatggccgt
gccatcggtgtgttagctgatttgcagggacccaaaattcgtatcggcaagtttgccgaa
ggcaaaatccacctcaaggaaggcgagccttttatcctcgacaccacttgcgccctcggc
gatcagacgcgggtgggggtgacctatccgcaactggtcggggatgtagaccggggcgcg
accctgctgctcaatgacggcatgatcgtcctctgggtagaaaaggtacaaggtcacgag
attcacacccgggtcgtgcaggggggtgaactatccaacaacaagggcatcaaccgggct
gggggcggactgaccgcaccggcgctgaccgacaaggacagggctgacattattaccgcc
gcgcgcctggaagccgactatctggcggtttcttttccgcgcagtgcagcagacatggat
gaagcccgccgtctcttccgggaggcgggcggacatggggcaatggttgccaaaatcgag
cgggccgaggcggtagaggccattgaagaaattctcgcggtctccgaagtcatcatggtg
gcgcgcggtgatctgggcgttgaaatcggcgacgccgcagtgccccccgtgcagaagcgg
attattgccctagcgcaaaaatacaaccgcctgaccatcacggcgacacagatgatggaa
tccatgattcatcagcccattcctacccgcgctgaagtatccgacgtcgccaatgccgtg
ctcgacgggactgatgccgtgatgttgtctgcagaaacggcgagcggcgcattccccgtg
gaggccgttgcggccatggatcgaacttgtcgcgaggtcgagcggcaggcacccatcaac
aataccctaccgattctcgaccggccactggaacggatggacgaaaccatcgcggctgcc
gccattttagccaccatgcgctcccccatcgtcgccatcgcggcgtttaccgaaagtggc
tccaccgccttatggttgtcccgtgccaatccccgggtgccgatctacgcgttaacgccg
caggtctatacccggcgcaaggtgactttgtatcgcggggtccacccggtgaattttccc
cagagtcgccatgatgatccggtgcaggtcatgcgggcggcagaagacgaactgcgacga
cgcggtgtcgttcgcaacggtgatctgatcctcattacgattggcgaacccatgggtgcc
tccggtggtaccaacaccctcaagctggtgcgtgtcggagatgttacgcatcgtgcttaa

DBGET integrated database retrieval system