KEGG   Aspergillus fumigatus: AFUA_1G11090Help
Entry
AFUA_1G11090      CDS       T01017                                 

Definition
(RefSeq) histone-lysine N-methyltransferase Clr4
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
afm  Aspergillus fumigatus
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AFUA_1G11090
Enzymes [BR:afm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AFUA_1G11090
Chromosome [BR:afm03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     AFUA_1G11090
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    AFUA_1G11090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 455 aa AA seqDB search
MLTGAFFPDITRLIGPASRDCLIEGLGNHSNPITSNSNTANNAIAKANTPDPNHVFNPKI
QNPSTPSPTPSSQQEAVGVVIPSPSRQLRKEIEKSVWVKAPPVTPEKTALSTEYYPIDAH
EKRALRGAYPSARKVKRSEIPFSIGTPGPILADRIPVQRQLHETLQRKLSKINGPPVTFA
PGEEDLLAVFASNFEFVNSYILRKGVSHIPADFIAGCDCKKICDPARCGCLEQDEESKEI
IVPYQRAQDDARLLVLTPDFLKRTDIIIECSSKCTCDERKCWNRVVQHGRTVRLEIFHTG
NRGFGLRSPDWIRAGQFIDCYLGEVITKQEADVREEVVTSQHGHSYLFELDFFHNDDEIY
VVDGQKFGSPTRFMNHSCNPNCKLFPVTRTYGDERLYDLAFFSLHNIPPNTELTFDYNPN
WEEGKKVDPNAVRCLCGEKNCRGQLWPNQRKGTKC
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgctgacaggggccttcttccctgacatcactagattgattgggcccgcgtctcgtgac
tgtctgatagaaggtcttggcaaccacagcaaccccatcacctccaacagcaatactgcc
aacaacgccattgctaaagctaatacacccgaccctaatcatgtattcaatccaaagatt
cagaatccgtcgacaccaagtccaaccccaagttctcaacaggaggcagttggtgtcgtt
attccttccccgtccaggcagctgagaaaggagattgagaaatccgtttgggtcaaagcg
ccccctgtaacgccagagaagactgcgctttcgactgagtattatccgattgatgctcat
gaaaagcgtgctctcagaggcgcgtatcctagcgctcgaaaggtcaagcgttctgagatt
ccctttagcattggaacgccaggccccattctagcagatagaattcctgtacaacgccaa
ttgcacgagaccctgcagcggaagctgtcaaagatcaatggcccccccgtgacatttgcg
ccaggggaggaggacctgctggcggtttttgcttcaaacttcgagttcgttaattcctat
atcctccgcaaaggtgtctcacacatcccggcggacttcatcgcaggctgtgattgcaag
aagatctgtgatcccgcgcggtgcggttgcctcgagcaggatgaagagtcgaaagagatt
attgtgccatatcaacgcgcacaagacgacgcacggctcttagtcctgaccccggacttt
ctcaaacgcacagatatcattattgaatgcagctccaaatgtacctgtgatgagcggaaa
tgctggaatcgagtcgtgcagcatggtcgtacggtccgtctggaaattttccacacaggg
aatcgcggcttcggtctccgttccccggactggatccgcgcgggtcaattcatcgactgc
tatctcggcgaagtgattacgaaacaagaagccgacgtgcgcgaggaggtggttacgtcg
cagcacggccactcctatctcttcgagctagacttcttccacaacgacgacgagatctac
gttgtggatggacaaaagtttggctcccccacgcgtttcatgaaccactcgtgcaacccc
aactgcaagttgttccccgtcacccggacctacggtgacgaacggctgtacgacctggcc
ttcttttcgctgcacaatatcccgcccaacaccgagctgacgttcgactacaaccccaac
tgggaggagggcaaaaaggtcgatcccaacgctgtgcgctgtctctgtggggagaagaac
tgccgcgggcagctctggccgaaccagcgcaagggcactaagtgctag

DBGET integrated database retrieval system