KEGG   Aspergillus fumigatus: AFUA_2G03310Help
Entry
AFUA_2G03310      CDS       T01017                                 

Definition
(RefSeq) nucleoporin Nsp1
  KO
K14306  nuclear pore complex protein Nup62
Organism
afm  Aspergillus fumigatus
Pathway
afm03013  RNA transport
Brite
KEGG Orthology (KO) [BR:afm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AFUA_2G03310
Messenger RNA biogenesis [BR:afm03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     AFUA_2G03310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nsp1_C Nucleoporin_FG ParB DUF1664 WXG100 DUF4200
Motif
Other DBs
NCBI-GeneID: 3506923
NCBI-ProteinID: XP_749466
UniProt: Q4WI27
LinkDB All DBs
Position
2
AA seq 703 aa AA seqDB search
MSNTFSFGAPASSGASSGSLFGTAGNAFGSNQNSSNTTTGGGLFGNVGASSSGTSTPSLF
GSAPATGKSGNTLFGGGTSATSSSTPTGSTPAFSFGTQTKSGSTPQSPSLFGGGSQTPKP
GESSASGQTGGNALFGNAAKPAGNIFGSAAATPAPSGGSLFGNTSTTPAGPPPQGTAAGQ
GQSLFGQAAQKPGGLFGGLNATTTSSSTASPTATTAPATGGTSTLFGGAQQSQSSGGGLF
GSNAQQKPMFGTTPSAPSGGGLFGNAAKDKPAESTTPTTTADGAAKPLFGAAPSAPAGQA
QGSSLFKMPSSSADSGSKPAFPSLGTTTTTTTSQPSTALTTSSDTPQKSLFPSLGGTTSA
TPSTTPAAAPAGGGLFGGLGASKPAETGAATTTTAPASQPAAATGGLFGKPAETTSSTQA
PSTAAGATATTAGAKPSLTATSGPATSATPTTTGTAAGTTTAAGGTALGASTVGPTPPAQ
SRLKNKTMDEIITRWATDLTKYQKEFREQAEKVAEWDRMLVENTAKVQKLYGSTVDADRA
TQEIERQLASVEGQQEELSSWLDRYEREVDEMMSKQVGPGEALQGPDQERERTYKLAERL
SEQLDEMGKDLTSMIEEVNGASATLSKTNKADEPISQIVRILNSHLSQLQLIDQGTSELQ
AKVSAAQKSGHILSSRFGHGFSSSGLGGGSAADDFYRSYMGRR
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacacattctcttttggtgcgccggcctccagcggcgcctcaagcggaagtcta
tttggaactgctggcaacgcttttggctccaatcagaacagctccaacaccaccaccgga
ggtggtctctttggcaatgtaggagcttcctctagcggcacttctacaccctcattattc
ggatcggcacctgcgacggggaaatctggcaataccctgtttggtggtggtaccagtgct
acgagcagcagcacacctaccggaagtacgcctgcatttagttttggaactcaaaccaag
tctggtagcacacctcagtcaccgtccttgtttggcggcggatcgcagacacccaaacca
ggagagtcttctgcttctgggcaaaccggcggcaatgctctcttcgggaatgccgcaaag
cctgctgggaatatattcggaagcgccgcagcgactcctgcgccatccggaggctcactc
ttcggcaacacctctaccacacctgctggccctccgccacagggaaccgcggccgggcag
ggacagtcgcttttcggacaggcagctcagaaaccaggcggtctcttcggtggactgaac
gcaacaactacttcctcatcgacagcctctcccacagccacgacggcgccggcgacgggc
gggacgtctacactttttgggggagctcaacagtcacaatctagcggaggtggtctcttt
gggtcgaacgctcaacaaaaaccaatgtttggaacgactccgtcggcgcccagtggcggt
ggtttgttcggcaatgcagccaaggacaagcctgcggaatcaacaaccccaacaaccact
gctgacggtgctgcgaaacccctctttggagctgccccgtcagcacccgctgggcaagct
caagggtcctcactcttcaagatgccatcctctagcgccgattcagggtcgaaacctgct
ttcccgtctctcggtacaactaccacaaccacgaccagccaaccttctacagccttgacc
acatcatccgacactccgcaaaagtcactattccccagtcttggaggtactacgtccgcg
accccgtcaactacaccagcggccgctccagctggaggtggtctgtttggtggactaggt
gcgtccaagcctgcggaaaccggtgcggcaacaaccaccaccgctcccgcttctcaaccc
gcagcggcgaccggcggactgttcggtaaacctgctgagaccacatcctccacacaggcc
ccgagcactgctgcgggcgccactgcaaccactgctggtgccaagccgtcgctcacagcg
acttccggcccggcaacatcggcaacgcccaccactactggaaccgctgccgggacgacc
acagcggccggaggtactgctcttggagcatccacggttggcccaacgcctccggcgcag
tctcgcctgaagaacaagaccatggatgagattatcacgaggtgggctaccgatttgacc
aagtaccaaaaggaattccgggagcaggccgagaaggttgcggaatgggaccgtatgttg
gtggagaatactgcgaaggtccaaaaactctatggcagtacagtcgatgccgaccgggcc
acacaggagatcgagcgccagctcgcatccgttgaagggcagcaggaagagcttagctcg
tggttggatcggtatgagcgtgaggtggatgagatgatgtcgaaacaagtgggacctggc
gaagccctgcaagggccggatcaggaacgtgaaagaacctacaaactggccgaaaggctg
tccgagcagttggacgaaatgggcaaggatttgacgagcatgattgaagaagtcaatggt
gcttcggctactctaagcaagaccaacaaggccgatgagccgatttctcaaatcgtgcgc
atcctcaactcgcatctttctcaactgcagcttatcgaccagggcacatccgagctccag
gcaaaggtcagcgccgcgcaaaagtctggacatatattgtcgtcgcggtttggtcatgga
ttcagcagctctgggctgggcggcggaagtgctgcggatgacttctatcgctcctacatg
ggacggcggtga

DBGET integrated database retrieval system