KEGG   Aspergillus fumigatus: AFUA_2G05910Help
Entry
AFUA_2G05910      CDS       T01017                                 

Definition
(RefSeq) hexokinase Kxk
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
afm  Aspergillus fumigatus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFUA_2G05910
   00051 Fructose and mannose metabolism
    AFUA_2G05910
   00052 Galactose metabolism
    AFUA_2G05910
   00500 Starch and sucrose metabolism
    AFUA_2G05910
   00520 Amino sugar and nucleotide sugar metabolism
    AFUA_2G05910
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AFUA_2G05910
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     AFUA_2G05910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 490 aa AA seqDB search
MVGIGPKRPPSRKGSMADVPQNLLQQIKDFEEMFTVDKAKLKQVVDHFVKELDKGLSVEG
GNIPMNVTWVMGFPDGDEQGTFLALDMGGTNLRVCEITLTEEKGGFDICQSKYRMPEELK
TGTAEELWEYIADCIQQFIEFHHGEEGLTSLPLGFTFSYPATQEYIDHGILQRWTKGFDI
DGVEGQDVVPPLEETLKRKGLPIKVAALINDTTGTLIASAYTDPEMKIGCIFGTGVNAAY
MENVGSVPKLAHMNLPPDMPVAINCEYGAFDNEHVVLPLTKYDHIIDRDSPRPGQQAFEK
MTAGLYLGEIFRLALIDLLDSRPGLIFQNQDTSKLRKPYLLDASFLAAIEEDPYENLQET
QELFERELNIKPTLAELEMIRRLAELIGTRAARLSACGVAAICKKKNIESCHVGADGSVF
TKYPHFKARGAQALREILDWAPNEKDKVTIMAAEDGSGVGAALIAALTLKRVKAGNLAGI
RNKDEMQKLL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtcgggatcggtcccaagcgccccccatcccgcaagggatcgatggccgatgtgcct
cagaatcttctacagcagattaaggatttcgaggagatgtttactgtggacaaagccaag
ctcaagcaggtggttgaccacttcgtcaaggagctcgacaagggtctcagcgtggagggt
ggaaacatcccgatgaacgttacctgggtgatgggcttccccgatggagacgagcagggg
accttccttgccctggatatgggtggcactaacctccgcgtctgtgagattaccttgacg
gaagagaagggaggcttcgatatctgccagtccaagtaccgcatgccggaagaactgaag
accggaaccgccgaggagctgtgggaatacatcgccgactgcatacagcaattcattgag
ttccaccacggagaggaaggattgacatcattgcccctgggtttcaccttctcctacccg
gctacacaagagtacattgatcatggtattcttcagcgctggactaagggcttcgacatt
gatggtgtcgagggacaggatgtcgtccctccccttgaggaaacgcttaagagaaaggga
cttcctatcaaggtcgctgctctgatcaacgataccactggaacgctcatcgcctcggcc
tacactgatcccgagatgaagattggatgtatttttggtacaggtgtcaatgcggcctac
atggagaacgttggttccgtccctaagctggcccacatgaacctgcccccagacatgcca
gtggccatcaattgcgagtacggtgctttcgacaacgagcacgtagtgcttcccctcaca
aagtatgatcatatcattgaccgcgactctccccgccccggccagcaggccttcgagaag
atgacagctggtctctacctgggagagatcttccgtctggccctgattgatcttctggac
agcagaccaggactgatcttccagaatcaggacaccagcaagctgcggaagccgtacttg
ctggacgcttccttcctggctgccatcgaggaggatccctacgagaacttgcaggaaacg
caggagctgttcgagcgcgaattgaacatcaagcccactctggccgagcttgagatgatt
cgtcgtctggccgagctgatcggtacgcgtgcagctcgtctgtcagcttgcggtgtggcc
gctatctgcaaaaagaagaacatcgagagctgccacgttggtgcagacggctccgtcttc
accaagtaccctcacttcaaggctcgcggtgcccaggctttgcgagagatcctggactgg
gccccgaacgagaaggacaaggtcaccattatggcggccgaggatggttctggtgtcggt
gccgcgctgatcgccgcgctgaccctcaagcgtgtcaaggccggcaacctggctggtatc
cggaacaaagacgaaatgcagaaattgctttga

DBGET integrated database retrieval system