KEGG   Aspergillus fumigatus: AFUA_2G05910Help
Entry
AFUA_2G05910      CDS       T01017                                 

Definition
(RefSeq) hexokinase Kxk
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
afm  Aspergillus fumigatus
Pathway
afm00010  Glycolysis / Gluconeogenesis
afm00051  Fructose and mannose metabolism
afm00052  Galactose metabolism
afm00500  Starch and sucrose metabolism
afm00520  Amino sugar and nucleotide sugar metabolism
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01130  Biosynthesis of antibiotics
afm01200  Carbon metabolism
Module
afm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
afm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFUA_2G05910
   00051 Fructose and mannose metabolism
    AFUA_2G05910
   00052 Galactose metabolism
    AFUA_2G05910
   00500 Starch and sucrose metabolism
    AFUA_2G05910
   00520 Amino sugar and nucleotide sugar metabolism
    AFUA_2G05910
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AFUA_2G05910
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     AFUA_2G05910
Membrane trafficking [BR:afm04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    AFUA_2G05910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 3506901
NCBI-ProteinID: XP_749720
UniProt: Q4WHC3
LinkDB All DBs
Position
2
AA seq 490 aa AA seqDB search
MVGIGPKRPPSRKGSMADVPQNLLQQIKDFEEMFTVDKAKLKQVVDHFVKELDKGLSVEG
GNIPMNVTWVMGFPDGDEQGTFLALDMGGTNLRVCEITLTEEKGGFDICQSKYRMPEELK
TGTAEELWEYIADCIQQFIEFHHGEEGLTSLPLGFTFSYPATQEYIDHGILQRWTKGFDI
DGVEGQDVVPPLEETLKRKGLPIKVAALINDTTGTLIASAYTDPEMKIGCIFGTGVNAAY
MENVGSVPKLAHMNLPPDMPVAINCEYGAFDNEHVVLPLTKYDHIIDRDSPRPGQQAFEK
MTAGLYLGEIFRLALIDLLDSRPGLIFQNQDTSKLRKPYLLDASFLAAIEEDPYENLQET
QELFERELNIKPTLAELEMIRRLAELIGTRAARLSACGVAAICKKKNIESCHVGADGSVF
TKYPHFKARGAQALREILDWAPNEKDKVTIMAAEDGSGVGAALIAALTLKRVKAGNLAGI
RNKDEMQKLL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggtcgggatcggtcccaagcgccccccatcccgcaagggatcgatggccgatgtgcct
cagaatcttctacagcagattaaggatttcgaggagatgtttactgtggacaaagccaag
ctcaagcaggtggttgaccacttcgtcaaggagctcgacaagggtctcagcgtggagggt
ggaaacatcccgatgaacgttacctgggtgatgggcttccccgatggagacgagcagggg
accttccttgccctggatatgggtggcactaacctccgcgtctgtgagattaccttgacg
gaagagaagggaggcttcgatatctgccagtccaagtaccgcatgccggaagaactgaag
accggaaccgccgaggagctgtgggaatacatcgccgactgcatacagcaattcattgag
ttccaccacggagaggaaggattgacatcattgcccctgggtttcaccttctcctacccg
gctacacaagagtacattgatcatggtattcttcagcgctggactaagggcttcgacatt
gatggtgtcgagggacaggatgtcgtccctccccttgaggaaacgcttaagagaaaggga
cttcctatcaaggtcgctgctctgatcaacgataccactggaacgctcatcgcctcggcc
tacactgatcccgagatgaagattggatgtatttttggtacaggtgtcaatgcggcctac
atggagaacgttggttccgtccctaagctggcccacatgaacctgcccccagacatgcca
gtggccatcaattgcgagtacggtgctttcgacaacgagcacgtagtgcttcccctcaca
aagtatgatcatatcattgaccgcgactctccccgccccggccagcaggccttcgagaag
atgacagctggtctctacctgggagagatcttccgtctggccctgattgatcttctggac
agcagaccaggactgatcttccagaatcaggacaccagcaagctgcggaagccgtacttg
ctggacgcttccttcctggctgccatcgaggaggatccctacgagaacttgcaggaaacg
caggagctgttcgagcgcgaattgaacatcaagcccactctggccgagcttgagatgatt
cgtcgtctggccgagctgatcggtacgcgtgcagctcgtctgtcagcttgcggtgtggcc
gctatctgcaaaaagaagaacatcgagagctgccacgttggtgcagacggctccgtcttc
accaagtaccctcacttcaaggctcgcggtgcccaggctttgcgagagatcctggactgg
gccccgaacgagaaggacaaggtcaccattatggcggccgaggatggttctggtgtcggt
gccgcgctgatcgccgcgctgaccctcaagcgtgtcaaggccggcaacctggctggtatc
cggaacaaagacgaaatgcagaaattgctttga

DBGET integrated database retrieval system