KEGG   Aspergillus fumigatus: AFUA_3G11120Help
Entry
AFUA_3G11120      CDS       T01017                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
afm  Aspergillus fumigatus
Pathway
afm00250  Alanine, aspartate and glutamate metabolism
afm00410  beta-Alanine metabolism
afm00430  Taurine and hypotaurine metabolism
afm00650  Butanoate metabolism
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
Module
afm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AFUA_3G11120
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFUA_3G11120
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AFUA_3G11120
   00430 Taurine and hypotaurine metabolism
    AFUA_3G11120
Enzymes [BR:afm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AFUA_3G11120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase Polysacc_deac_2 SepSecS
Motif
Other DBs
NCBI-GeneID: 3512083
NCBI-ProteinID: XP_754507
UniProt: Q4WXY4
LinkDB All DBs
Position
3
AA seq 572 aa AA seqDB search
MSVSPPSSRAEEVRKLLGAVEDLLIPFIQSADENPLGLALQQNGVNGTNDTNGTNGHLKS
PRTALVDYKNPEELRDILQLSLPEKGTRQEGLIEVLRKVLKYSVNTWHQGFLDKLYASTN
APGVASELILAALNTNVHVYQVSPALTIIEKFTGEKLASLFGLNGPRAGGISVQGGSASN
TTSIVIARNNLYPDTKKNGNGDYKFVVFTSDHGHYSIEKAAQMLGLGSSSVWVVPVDKQG
RMIPEELEKLVRKALQENRTPFYVNATAGTTVMGSFDPFNEIAAICQKYNLWFHVDGSWG
GSFVFSKRQKHKLAGVDKANSIAINPHKMLGVPVTCSFLLAADIRQFHRANTLPAGYLFH
NNDTEPQPNGDLGTSENELSVDSPEVWDLADLTLQCGRRADSLKLFLGWTYYGTEGYEQQ
IDTACDIAAHLATLVSESPNFILISENPPPCLQVCFYYAPGGQLVHPRGVVSNETERAKA
NSKVTEELTHALVHKGFMVDFAPPSGDEDAAGDGKFFRCVVNVQTTRETVEALVRAIEEA
GPAIIERLKAEAASIPKRRPGERGHGPVVHQG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgtccccgccgtcgagtcgcgctgaggaagtgcgaaagcttctgggtgcagtc
gaagatctcctcatcccattcatccagtccgccgacgaaaatcctcttggccttgcgctc
cagcaaaatggggtcaatggaacgaatgatacgaatggtacgaatggacacctgaaaagt
ccacggacagctttagtcgattacaaaaatcctgaagagcttcgggatattctgcaatta
tctctaccggagaagggtaccagacaagagggcttgattgaggttcttcgcaaagtgttg
aagtattccgtgaatacatggcatcagggatttctcgacaaactatatgcctcaacgaat
gctcccggtgtggcatccgagctgattttggcggctctcaacacgaacgtgcatgtctac
caggtctcgccggctttgactattatcgaaaagtttacaggagaaaagttggcttctcta
tttgggctcaacggaccacgagcagggggaatttctgtacaagggggctcagcatccaac
accacctcgattgtcattgcgcgcaacaacctataccccgatacaaagaaaaatggcaat
ggggactacaagtttgtggtcttcaccagcgaccacggccactacagcatcgagaaggcg
gcacagatgctgggtttgggaagcagctccgtctgggtagtgcccgtggacaagcaaggt
cgcatgatcccggaagaactcgagaagctggttcgaaaagctctccaggagaacaggaca
ccgttctatgttaatgcaactgccggaacgacggtaatgggctcctttgaccccttcaat
gagatcgctgccatctgccagaaatacaacctctggttccacgttgacggctcgtggggc
ggttcgttcgtcttctccaagcgccagaagcacaaactcgctggcgtcgacaaagcaaat
agcatcgccataaaccctcacaaaatgctcggtgttcccgtgacttgttctttcctccta
gcggcggacattcgccagttccacagggcaaatactctcccagccggctacttattccac
aacaacgacacggaaccgcaacccaacggcgacctcggcacatcggaaaacgagctctcc
gtcgattcaccggaggtctgggacctggctgaccttactctccaatgtggacgacgcgca
gactccctcaagctctttttgggctggacatactacggcacggagggatacgagcagcag
atcgacacggcctgtgacattgctgcacacctggcgacactcgtctccgaaagccctaac
ttcatcctcatcagcgagaacccacccccatgtctccaggtttgcttctactacgcgccg
ggcggacagctcgtacaccctcgcggagttgtatcgaacgagaccgagcgtgcaaaggca
aacagcaaagtcacggaagagctgacccatgctctagtgcacaaggggttcatggttgac
tttgcacctcctagcggggacgaggacgctgccggggatggaaagtttttccgctgcgtt
gtcaatgtccagacaactcgcgagactgttgaagctcttgttcgtgctattgaggaggcg
ggcccggccatcatcgaaagacttaaggccgaggctgcttcgattcccaaacgtaggccg
ggagaacgaggccacggacctgttgttcaccaggggtag

DBGET integrated database retrieval system