KEGG   Aspergillus fumigatus: AFUA_4G10130Help
Entry
AFUA_4G10130      CDS       T01017                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
afm  Aspergillus fumigatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFUA_4G10130
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AFUA_4G10130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4
AA seq 494 aa AA seqDB search
MHIRWSSFFLSCLAGTALAATPAQWRSQSIYFLLTDRFARTDGSTTASCDTSARYCGGTW
QGIIEQLDYIQGMGFTAIWITPVTKQLPQDTSEGTAYHGYWQQDIYSVNSNYGTADDLKA
LASALHDRGMYLMVDVVANHMGYAGAGDSVDYSVFNPFNSQTSFHPLCFISNYDNQTDVE
NCWLGDNSVPLPDLDTTNPDVQKIWYNWVNSLVSNYSIDGLRIDTVKHVQSDFWPGFNDA
AGVYCIGEVFDGDPAYTCPYQEVLDGVLNYPIYYPLLKAFQSTSGSMSSLYDMINTVKSQ
CADSTLLGTFVENHDTPRFASYTKDMALAKNAAAFIIFSDGIPIIYAGQEQHYSGGADPA
NREAVWLSGYSTTSDLYKLIATANAIRSHAISKDPGYVTYKNNPIYKDTSTIAMRKGSDG
AQIITVLSNLGASGSSYTLSLGGTGYEAGQQLTEMFSCTTVTVGSDKKVPVSMASGLPRV
FYPTAGLNGSTVCT
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcatatacgctggtcatccttttttctttcttgccttgctggaacagctttggcggcc
actccagcgcaatggcgatcccagtccatctatttcttactcacggatcgattcgcaagg
actgacggttccacaacggcctcgtgtgatactagtgctcgatattgtggtggtacatgg
caaggcattattgaacaactcgattacatacaaggcatgggctttacagcaatttggata
accccagtcaccaagcaacttccccaggatacgtcggaaggcactgcataccacgggtac
tggcagcaagacatttattcggtcaattccaactatgggaccgctgacgacctgaaagcc
ctggcgtcagctcttcatgacaggggcatgtatctcatggtcgatgttgttgccaatcac
atgggatatgccggtgcaggcgattcggtcgactatagtgtcttcaaccccttcaactcc
cagacctccttccacccattgtgcttcatcagcaattacgataatcagacagacgtggaa
aattgctggttgggggacaattcggttcctttacccgatcttgatactacaaatccggat
gttcaaaagatttggtacaattgggtgaactctttagtgtctaattattccatcgacggc
ctacgaattgacactgtgaagcacgtccagagcgatttctggccgggattcaatgacgcc
gcaggcgtctactgtatcggggaggtatttgatggagatccagcgtacacttgtccctac
caagaggtcctggacggggtgctgaattaccctatatattatccgcttctgaaagccttc
caatccacaagtggcagtatgagcagcctctacgatatgatcaacacggtcaagtcgcag
tgcgccgattcgacgctgttgggcacctttgtcgaaaatcacgatactccccggttcgca
tcgtataccaaggacatggccctcgctaaaaacgccgcagcattcatcatcttctccgat
ggaatcccaatcatctacgccggccaggagcaacattacagcggcggcgcggatcccgca
aaccgtgaggcagtctggctatccggctactcgacaacgagtgacctatacaagctcatc
gcgacagcaaacgccatccggagtcacgccattagcaaggacccgggatacgtgacttat
aagaataaccccatctacaaagatacctccaccatcgccatgcgaaaaggctccgacgga
gcgcagatcatcaccgtcctctcgaacctcggtgcttctggaagctcttacacgctctca
ttgggtggaacaggctatgaggccggacaacaactgactgagatgttctcctgcaccacg
gtgaccgtgggctcagacaaaaaggtccccgtttccatggctagtggcttgccccgggtg
ttttacccaacggctgggctgaacggaagtactgtttgtacttga

DBGET integrated database retrieval system