KEGG   Aspergillus fumigatus: AFUA_4G11580Help
Entry
AFUA_4G11580      CDS       T01017                                 

Definition
(RefSeq) Mn superoxide dismutase SodB
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
afm  Aspergillus fumigatus
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:afm00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AFUA_4G11580
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AFUA_4G11580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4
AA seq 229 aa AA seqDB search
MAASLIRTSARTALRSGASAAPRAATSLTFARGKATLPDLSYDYGALEPSISGKIMELHH
KNHHQTYVNSYNQAIEQLQEAQAKNDIASQIALKPLINFHGGGHLNHTLFWENLAPKSSG
GGEPPSGALAKAIDETYGSLENFQGKMNTALAGIQGSGWAWLVRDKQTGHIGIKTYANQD
PVVGQFQPLLGIDAWEHAYYLQYQNRKAEYFKAIWEVINWKAVEKRFSA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctctctcatccgtacctctgcgcgtaccgccctccgctcgggagcttcggct
gctccaagagctgctacgagcttgacttttgctcgcggcaaggccactctgcctgatcta
tcttacgattatggtgctctggagccttcgatctctggcaagatcatggagcttcaccac
aagaaccaccaccagacctatgtcaacagctacaaccaggccatcgagcagctgcaggag
gctcaggccaagaatgacattgcgtctcagatcgccctgaagcccctgatcaacttccac
ggcggtggtcacctcaatcacactcttttttgggagaatctggcccctaagagctctggt
ggtggtgagcccccgagtggtgcgctggccaaggccatcgatgagacatatggcagcttg
gaaaacttccaaggtaagatgaacaccgctttggccggcatccagggaagcggatgggct
tggcttgtcagggacaagcagaccggacacattggcatcaagacctatgccaaccaagac
cctgttgttggtcagttccagcctcttcttggcattgacgcctgggagcatgcttattat
ttgcaataccagaaccgcaaggccgagtacttcaaggccatctgggaggttatcaactgg
aaggctgtggagaagcgcttctccgcatag

DBGET integrated database retrieval system