KEGG   Acidithiobacillus ferrooxidans ATCC 23270: AFE_0311Help
Entry
AFE_0311          CDS       T00810                                 

Gene name
tuf-2
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
afr  Acidithiobacillus ferrooxidans ATCC 23270
Brite
Translation factors [BR:afr03012]
 Eukaryotic Type
  Elongation factors
   AFE_0311 (tuf-2)
 Prokaryotic Type
   AFE_0311 (tuf-2)
Mitochondrial biogenesis [BR:afr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AFE_0311 (tuf-2)
Exosome [BR:afr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AFE_0311 (tuf-2)
  Exosomal proteins of breast cancer cells
   AFE_0311 (tuf-2)
  Exosomal proteins of colorectal cancer cells
   AFE_0311 (tuf-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
275372..276562
Genome map
AA seq 396 aa AA seqDB search
MSKGKFERTKPHVNVGTIGHVDHGKTTLTAALTKVLSAKFGGEIRAYDQIDNAPEERARG
ITIATSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDAELLELVEMEVRELLSKYEFPGDDIPVIIGSALKALE
GDQSDIGEPAIFRLADAMDSYIPMPERPVDKPFLMPIEDVFSISGRGTVVTGRIERGIVK
IGDEIEIIGIHNTAKSIVTGVEMFRKILDQGQAGDNVGVLLRGTKKDDVERGQVLAKPGS
IKPHTRFEAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDVTGAVELPEGVEMVMPGDNIL
FKVALIAPIAMEEGLRFAVREGGRTVGAGVVSKVVE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagggaaatttgagcggacgaagccgcatgtcaacgtgggaacgattggtcac
gtggaccatggcaagaccacattaacggcggcgctgacgaaggtgttgtcggcgaagttt
ggcggtgagattcgcgcctatgatcagattgacaatgcgccggaagagcgggcgcgaggg
atcacgatagcgacctcgcacgtagaatacgagaccgcgaatcgtcactatgcccatgta
gactgtccggggcatgccgactatgtgaagaacatgattaccggagcggcgcagatggac
ggcgccatactggtgtgttcggcagcggacggtccgatgccgcagacccgcgaacatatt
ttgcttgcccgtcaggtgggcgttccctatatcgtcgtgtttttgaacaaggcggacatg
gtggatgacgccgagctgctggagttggtggaaatggaagtgcgcgaacttctgtccaag
tacgagtttcccggtgatgacattccggtgattatcggttcggcgctgaaggccctggaa
ggggatcagagcgacataggggagcctgcgattttccgtttggcggatgcgatggacagc
tacatcccgatgcccgagcgtcccgtggacaagcccttcctgatgccgatagaagacgta
ttttcgatttcgggtcgtggcacggtggtgaccggacgtattgagcgtggcattgtgaag
attggcgatgagatcgagatcatcggcattcacaacaccgccaagagcattgtcactggt
gtggagatgttccgcaagattctggatcaggggcaggccggagacaacgtcggggtactg
ctgcgcggcacgaagaaagatgatgtggagcgtggtcaggtactggccaagccgggcagc
atcaagccgcatacgcgttttgaagcggaagtatatgtgttgtcgaaagaggaagggggt
cgacacacgccgtttttcaatggttaccgcccgcagttttactttcgtaccactgacgtg
acgggtgcggtggagttgccggaaggtgtggagatggtgatgccgggcgacaatatattg
ttcaaggtcgcgttgattgcgccgattgcgatggaggaaggtctgcgtttcgcggtgcgc
gaaggcggccgtaccgttggcgccggcgtcgtctccaaggtggtcgaataa

DBGET integrated database retrieval system