KEGG   Actinoplanes friuliensis: AFR_18520Help
Entry
AFR_18520         CDS       T02892                                 

Definition
(GenBank) acyl-CoA synthase
Organism
afs  Actinoplanes friuliensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4024309..4026075
Genome map
AA seq 588 aa AA seqDB search
MVELRTAESIPAVLRKSVENTPDRGASAFVTHLDDPTGVAWLTYAELDRRARAAAVQFSA
HAAPGDRMLLLHPAGPDFLIALLGCLYAGLVAVPSPLPGRYAHQRRRLRLIAADADVAAV
LTAGESRDEVTGWAAEQELGAVPVLTLDGTADADAWTPPPLSQDTVAVLQYTSGSTGDPK
GVVIDHGNILHNAATIIAVTGMRPGYAVGGWLPHFHDMGLMGLLLPPLLAGSASVMTSPM
AFLKRPLLWLQMIDRFNIEISAAPDFAYDLCVAKVTDAQLAGVDLSRWRVAIDGSEPVRA
AVLTRFQERFAAAGLRPEAVTPSFGMAEATLFVSGAPDTPFVIRHADTDLLQRNEFRPAT
GDRPGRDVVSCGAPVDVEVRIVDPDSTEVLADGQVGEIWLRGPSIGRGYWGRDAGTAGFG
AVTSTGDGGYLRTGDLGTLFEGELYVTGRRKDMLVLRGRNYYPQDIEHELRVHHPELSGR
VGACFSVRSRDEAGGGEEVLVVTHEVRGISDPDRLSALAAAMRLTVAREFGVQSAAVLLL
RPGAVARTTSGKIQRAAMRELFETGALEPVAGDVDHRHVAGPAAVAAR
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggtggagctgcggacggcagaaagcattccggcggtcttgcggaaaagcgtggagaat
acgccggaccgcggagcctcggcttttgtcacgcatctcgacgaccccaccggtgtcgcc
tggctgacctacgccgagctggatcggcgggcccgcgccgcggccgtccagttctcggcg
cacgccgcccccggcgaccggatgctgctgctgcacccggccgggcccgacttcctgatc
gcgctgctcggctgtctctacgccggcctggtcgcggtcccgtcccccctgcccggccgg
tacgcccaccagcgccgccggttgcgcctgatcgccgccgacgccgacgtggcggccgtg
ctgaccgccggcgagtcccgcgacgaggtcaccggctgggccgccgagcaggagctcggc
gcggttcccgtgctgacgctggacggcaccgccgacgcggacgcttggacaccgccgccg
ttgagccaggacacggtcgccgtcctgcagtacacgtccgggtccacgggcgaccccaag
ggtgtggtcatcgaccacggcaacatcctgcacaacgccgccacgatcatcgcggtgacc
gggatgcgaccggggtacgccgtcggcggctggctcccgcacttccacgacatggggctg
atgggcctgctgctgccgccgttgctggccggttcggcgagcgtgatgaccagcccgatg
gcgttcctcaagcgcccgctgctctggttgcagatgatcgaccggttcaacatcgagatc
agtgccgcccccgacttcgcctacgacctgtgcgtcgcgaaggtcaccgacgcccagctc
gccggcgtcgacctgtcgcgctggcgggtggccatcgacggctccgagcccgtccgcgcg
gcggtcctcacccgtttccaggagcggttcgcggccgccgggctgcggcccgaggcggtg
acccccagcttcggcatggcggaggcgacactgttcgtctccggcgccccggacaccccg
ttcgtcatccgtcacgccgacacggatctgctgcagcgcaacgagttccggcccgcgacc
ggcgaccggcccggccgtgacgtggtgtcctgcggcgcacccgtggacgtcgaggtgcgg
atcgtcgacccggacagcaccgaggtcctcgcggacggtcaggtcggcgagatctggctg
cgcggcccgtcgatcgggcgcggttactggggacgcgacgcggggacagcgggcttcggt
gcggtgaccagcaccggtgacggcggctatctgcgtaccggtgatctcggcacgctcttc
gagggtgagctctacgtgaccggccggcgcaaggacatgctcgtcctgcgcggccgcaac
tactacccgcaggacatcgaacacgagctgcgggtgcaccatcccgagctgtccgggcgc
gtcggcgcctgcttctccgtgcgatcgcgcgacgaggcgggcgggggcgaggaggtcctc
gtggtcacccacgaggtgcgggggatctccgatccggaccggctgtccgccctcgcggcg
gccatgcggctgaccgtggcccgggagttcggtgtgcagagcgcggcggttctgctgctg
cgcccgggtgcggtcgcccgcacgaccagcggcaagatccagcgggcggcgatgcgggag
ctcttcgagacgggcgcgctggagcccgtcgccggggacgtcgaccaccggcacgtcgcc
ggcccggccgcggtggcggcccgatga

DBGET integrated database retrieval system