KEGG   Anaeromyxobacter sp. Fw109-5: Anae109_1785Help
Entry
Anae109_1785      CDS       T00559                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
afw  Anaeromyxobacter sp. Fw109-5
Brite
Enzymes [BR:afw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Anae109_1785
Peptidases [BR:afw01002]
 Metallo Peptidases
  Family M2
   Anae109_1785
Exosome [BR:afw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Anae109_1785
CD molecules [BR:afw04090]
 Proteins
  Anae109_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2015911..2017779
Genome map
AA seq 622 aa AA seqDB search
MRHILLVTALLLSTAAGGAAAEPSDPDARATVVAPAPSSKPPTAAEAKAFVDGVNAELKR
LWIRSSTADWIKATYITDDTERNAAALNEDVMAYLSRAIAESVRFDGVKADADTARMLHL
LKVASSLPAPSDAARRRELAEISAKLEGIYGKGKWCGTPAPGRAAPRCRDLQQLEEVLAK
SRSYPELLDAWTGWHTISREMRPLYERLVTLGNEGAREIGFSDLGDLWRADYDMAPEAFE
ADVGRLWAEVKPLYDELHCYVRGRLQQAYGKAKVPDGKPIPAHLLGNMWAQDWSNLYPLV
EPFKGVGSLDVDAALKRQKYDAARMVKLGEAFFTSLGLEPLPPSFWERSQLVKPRDREVV
CHASAWDVTFAADLRIKMCIRPIEEDLVTIHHELGHNYYQRAYVHLPLLFQDSANDGFHE
ALGDAIALSVTPGYLKQVGLVPGVPKDDRGTINFQMKKALEKIAFLPFGLLIDQWRWDVF
SGKVPPDRYNAAWWELRRKYQGVDAPVARSEADFDPGAKYHIPSNVPYTRYFLAHVYQFQ
FHQALCEAAGWKGPLHQCSIYGSKDAGKRLVAMMELGASRPWPEAYAALAGAKQADASAL
LAYFAPLRKWLAEQNAGRTCGW
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagacacattctcctcgtcacagcactgctgctctccacggccgcggggggcgccgcc
gccgagccctccgaccccgacgcccgcgcgaccgtcgtcgctccggcgccctcctcgaag
ccgcccaccgccgcggaggcgaaggcgttcgtcgacggcgtcaacgccgagctgaagcgg
ctctggatccgctcgtccaccgccgactggatcaaggccacctacatcaccgacgacacc
gagcggaacgccgccgccctcaacgaggacgtcatggcgtacctctcgcgcgccatcgcc
gagtcggtccgcttcgacggcgtgaaggcggacgccgacaccgcgcgcatgctgcacctg
ctcaaggtcgcctcgtcgctgcccgcgccgagcgatgcggcccgccggcgggagctcgcc
gagatctccgcgaagctcgaggggatctacggcaagggcaagtggtgcgggacgcccgcg
ccgggcagggcggcgccgcgctgccgcgacctgcagcagctcgaggaggtcctcgcgaag
agccgcagctaccccgagctgctcgacgcctggaccggctggcacaccatctcgcgcgag
atgcgcccgctgtacgagcggctcgtcaccctcggcaacgagggggccagggagatcggc
ttcagcgatctcggcgacctctggcgcgccgactacgacatggcgcccgaggcgttcgag
gccgacgtcggccggctgtgggcggaggtgaagccgctctacgacgagctccactgctac
gtgcgcggccggctccagcaggcctacgggaaggccaaggtccccgacggaaagccgatc
ccggcgcacctgctcggcaacatgtgggcgcaggactggtcgaacctctacccgctcgtc
gagccgttcaagggcgtggggagcctcgacgtggacgcggccctgaagcgtcagaagtac
gacgcggcgcggatggtgaagctcggcgaggcgttcttcacctcgctcggcctcgagccg
ctcccgcccagcttctgggagcgctcccagctcgtgaagccgcgcgaccgggaggtggtg
tgccacgcgagcgcgtgggacgtcaccttcgccgccgacctgcgcatcaagatgtgcatc
cggcccatcgaggaggacctcgtcaccatccaccacgagctgggccacaactattaccag
cgcgcctacgtccacctgccgctgctcttccaggacagcgccaacgacggcttccatgag
gcgctcggcgacgcgatcgcgctctccgtgacgccgggatatctgaagcaggtcgggctc
gtcccgggcgtcccgaaggacgaccgcggcaccatcaacttccagatgaagaaggcgctc
gagaagatcgccttcctcccgttcgggctcctcatcgaccagtggcgctgggatgtgttc
agcgggaaggtgccgccggaccgctacaacgccgcgtggtgggagctccggcggaagtac
cagggcgtcgacgccccggtcgcgcggagcgaggccgacttcgacccgggcgccaagtac
cacatcccctcgaacgtcccgtacacccgctacttcctggcgcacgtgtaccagttccag
ttccaccaggcgctgtgcgaggcggccggctggaaggggccgctccaccagtgctcgatc
tacggctccaaggacgccggcaagcggctcgtggcgatgatggagctcggcgcgtcgcgg
ccgtggccggaggcgtacgcggccctcgccggcgcgaagcaggccgacgcgtcggcgctg
ctcgcgtacttcgcccctctccgcaagtggctcgcggagcagaacgcgggccgcacgtgc
gggtggtga

DBGET integrated database retrieval system