KEGG   Addendum: AAA39896Help
Entry
AAA39896          CDS       T10000                                 

Gene name
Pcsk1
Definition
(KEGG) proprotein convertase 1 (EC:3.4.21.93)
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Taxonomy
TAX:10098
  Lineage
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus
Organism
ag  Addendum (Mus cookii)
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert Peptidase_S8_N OmpA_membrane
Motif
Other DBs
NCBI-ProteinID: AAA39896
GB: M58507
UniProt: P63240
LinkDB All DBs
AA seq 753 aa AA seqDB search
MEQRGWTLQCTAFAFFCVWCALSSVKAKRQFVNEWAAEIPGGQEAASAIAEELGYDLLGQ
IGSLENHYLFKHKSHPRRSRRSALHITKRLSDDDRVTWAEQQYEKERSKRSVQKDSALDL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWEKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDLTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ASNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRNVPEKKECVVKDNNFEPRALK
ANGEVIVEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAVGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPVGTWTLKITDMSGRMQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVNVVEKRPTQKSLNGNLLVPKNSSSSNVEGRRDEQVQ
GTPSKAMLRLLQSAFSKNALSKQSPKKSPSAKLSIPYESFYEALEKLNKPSKLEGSEDSL
YSDYVDVFYNTKPYKHRDDRLLQALMDILNEEN
Reference
PMID:1988934
  Authors
Smeekens SP, Avruch AS, LaMendola J, Chan SJ, Steiner DF
  Title
Identification of a cDNA encoding a second putative prohormone convertase related to PC2 in AtT20 cells and islets of Langerhans.
  Journal
Proc Natl Acad Sci U S A 88:340-4 (1991)
DOI:10.1073/pnas.88.2.340

DBGET integrated database retrieval system