KEGG   Addendum: ABS72370Help
Entry
ABS72370          CDS       T10000                                 

Gene name
lig
Definition
(KEGG) DNA ligase (ATP, ADP or GTP) (EC:6.5.1.7)
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Taxonomy
TAX:53426
  Lineage
Archaea; Crenarchaeota; Thermoprotei; Desulfurococcales; Desulfurococcaceae; Sulfophobococcus
Organism
ag  Addendum (Sulfophobococcus zilligii)
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ABS72370
GB: EF506613
UniProt: D2CJS7
LinkDB All DBs
AA seq 606 aa AA seqDB search
MPDMPLRILVETIERLELVTARTQLVAFLVNLFKQTPPEIIDKVVYLVQGILWPDWKGMP
ELGVGEKMLIKAISLACNISEREVEKTAKEIGDIGKATEKLKQTAQSKQTGLTIFAFTQQ
PTGLTVTNTYNTLVKIAMAQGEGSKDLKIRLLAGLLKDASPKEAKFIVKFVEGKLRVGIG
DATIMDALAVTFGGGVANRPVIERAYNLRSDLGEVAKILASKGIEELKKIKPEVGVPIRP
MLAERLSDPREILVKTGGEAFVEYKYDGERAQIHKKGDKIWIYSRRLENITSQYPDVVER
ALEKIKADEAIVEGEIVVYDPDTGELKPFQELMHRKRKHDIRQAIKEYPVKVFLFDLLYL
NGEDYTLKPLPVRREALEKIIDKTEDFTIAEYIKTSNPEELEKFFLEAIGNGVEGVMAKA
IHKDSIYQAGVRGWLWIKYKRDYKSEMADTVDLVVVGAFYGKGRRGGKYGALLMAAYNKE
KDVFETVCKVGSGFKDEDLDKLPDMLKPYIRDRKHPRVVAEIEPDVWVDPVLVAEIIGAE
LTLSPIHTCAKGVIKPDAGISIRFPRFIRWRPDKRPEDATTSSELVEMYQRQLKKITTEQ
ATQEQL
Comment
Unpublished sequence data: Seo MS, Kwon ST (2007).
Reference
  Authors
Sun Y, Seo MS, Kim JH, Kim YJ, Kim GA, Lee JI, Lee JH, Kwon ST
  Title
Novel DNA ligase with broad nucleotide cofactor specificity from the hyperthermophilic crenarchaeon Sulfophobococcus zilligii: influence of ancestral DNA ligase on cofactor utilization.
  Journal
Environ Microbiol 10:3212-24 (2008)
DOI:10.1111/j.1462-2920.2008.01710.x

DBGET integrated database retrieval system