KEGG   Addendum: CAA76703Help
Entry
CAA76703          CDS       T10000                                 

Gene name
CYP503A1
Definition
(KEGG) ent-kaurene oxidase
  KO
K21292  
ent-kaurene oxidase [EC:1.14.13.78]
Taxonomy
TAX:5127
  Lineage
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Nectriaceae; Fusarium; Fusarium fujikuroi species complex
Organism
ag  Addendum (Fusarium fujikuroi)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
GB: 
UniProt: 
LinkDB All DBs
AA seq 525 aa AA seqDB search
MSKSNSMNSTSHETLFQQLVLGLDRMPLMDVHWLIYVAFGAWLCSYVIHVLSSSSTVKVP
VVGYRSVFEPTWLLRLRFVWEGGSIIGQGYNKFKDSIFQVRKLGTDIVIIPPNYIDEVRK
LSQDKTRSVEPFINDFAGQYTRGMVFLQSDLQNRVIQQRLTPKLVSLTKVMKEELDYALT
KEMPDMKNDEWVEVDISSIMVRLISRISARVFLGPEHCRNQEWLTTTAEYSESLFITGFI
LRVVPHILRPFIAPLLPSYRTLLRNVSSGRRVIGDIIRSQQGDGNEDILSWMRDAATGEE
KQIDNIAQRMLILSLASIHTTAMTMTHAMYDLCACPEYIEPLRDEVKSVVGASGWDKTAL
NRFHKLDSFLKESQRFNPVFLLTFNRIYHQSMTLSDGTNIPSGTRIAVPSHAMLQDSAHV
PGPTPPTEFDGFRYSKIRSDSNYAQKYLFSMTDSSNMAFGYGKYACPGRFYASNEMKLTL
AILLLQFEFKLPDGKGRPRNITIDSDMIPDPRARLCVRKRSLRDE
Reference
  Authors
Tudzynski B, Hedden P, Carrera E, Gaskin P
  Title
The P450-4 gene of Gibberella fujikuroi encodes ent-kaurene oxidase in the gibberellin biosynthesis pathway.
  Journal
Appl Environ Microbiol 67:3514-22 (2001)
DOI:10.1128/AEM.67.8.3514-3522.2001

DBGET integrated database retrieval system