KEGG   Anopheles gambiae (mosquito): AgaP_AGAP005234Help
Entry
AgaP_AGAP005234   CDS       T01036                                 

Gene name
CUSOD2
Definition
(RefSeq) AGAP005234-PB
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Peroxisome
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:aga00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AgaP_AGAP005234 (CUSOD2)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    AgaP_AGAP005234 (CUSOD2)
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AgaP_AGAP005234 (CUSOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
LinkDB All DBs
Position
2L
AA seq 171 aa AA seqDB search
MKVLIALSTVLCVVLAKDQPRKAIVYLQGTSGVSGNVTISQPSCTEPVFIDINVVGLTPG
KHGFHIHEKGDLTDGCASTGGHYNPDKVSHGAPNDQVRHVGDLGNIAADENGIAKTSYSD
TVVSLYGARSVIGRAIVIHAEVDDLGKTNHPDSLKTGNAGGRVACGVIGIL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgctaattgctctatcgaccgtgctgtgcgtcgtgctggcgaaggaccagccc
cggaaggcgatcgtttacctgcagggtacgtctggcgtgagcggtaacgtgaccatctcg
caaccgtcatgcaccgagccggtgttcatcgacatcaacgtcgtggggctgaccccgggc
aagcatgggttccacattcacgagaagggtgacctgacggacggttgtgccagcaccggc
ggtcactacaatcccgacaaggtcagccacggggccccgaacgatcaggtgcgtcacgtc
ggcgatctcggtaacattgccgcggacgagaacggcatcgcgaaaacgtcctactcggac
acggtcgtgtcgctgtacggagcgcgcagcgtgatcggccgggcgatcgtcatccacgcg
gaggtggacgatctcggcaagacgaaccatccggactcgctgaagactggaaatgccggt
ggacgcgttgcctgcggcgtgattggaattctgtaa

DBGET integrated database retrieval system