KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007982Help
Entry
AgaP_AGAP007982   CDS       T01036                                 

Gene name
ANCE8
Definition
(RefSeq) AGAP007982-PA
Organism
aga  Anopheles gambiae (mosquito)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
LinkDB All DBs
Position
3R
AA seq 623 aa AA seqDB search
TSNDNLSEAIQFLREYDREAAEMCNRVANAEWRFSTNATEYNKRRMREQQNLASKLECIS
WRRAVSFDSSRIIDTSIRRQLGRIVQQGRCGLGDTKYAELQHVLMLLKDNYNGAKVCPFR
RGGSEATDLGTFSSAGGGVGYPSSNYVSAYAGYCDLKINSDLTRIMETSRSEPELRYYWV
AWREKTGPPVRNTFMRYLNLANQAAEQHGFHDAGEQMRSVYEDGDFFFTVNDLWGQLQPL
YKQLFTFVRKGLIRQYGEHVIRREGPLPAHLLGNMWGQNWRHIMDIIKPGPPETPDVSGE
MVRQGYTPMKIFQTAEEFFTSIGLSPMAPEFWRNSVLQKPNDGSGQCSASAWDFCNKVDF
RIKQCTQVSLDDFVGAHHEMTHIQYYMQYAGQPYLYREGPNPAFHEALANAITLSVGGPA
HLQKIGLLNSPVTVANGNSMVNIEYLLNLALDKLPFMAFSLALEKWRWYVFEKGPVGMNA
RWWELRLRYQGVIPPTGRGFEHFDAGAKYHVISDQDYIKYFVATVLQFQIYSELCQAAQH
FGPLHTCDIYRSREAGRILSDVMQQGASLSSAQLIKLLTRGKSSRLSVDPLLEFFRPLEA
WLEAQNRDEQARYDSAFPPLISH
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
acgagcaatgataatctgtccgaggcgatccagtttttgcgtgaatatgatcgcgaggcg
gcggaaatgtgcaaccgggtggcaaatgcggaatggcgcttttccaccaacgctaccgag
tacaacaagcgccgtatgcgcgagcagcaaaatttggcctcaaagcttgagtgcattagc
tggcggagggccgtatccttcgattcgtcgcgcataatcgacaccagcattcggaggcag
cttggtcgaatcgtgcagcagggcagatgcggtctgggcgataccaagtatgctgagctg
cagcacgtgttgatgctgttgaaggataactacaacggagcgaaagtgtgcccgtttcga
cgcggtggatcggaagcaaccgatctgggaacgttttcttcggcgggtggtggtgtgggc
tatccgagctcgaactatgtgtcggcgtacgcgggatattgcgatctgaagattaactcc
gatttgacgcgcattatggagacgagtcgttcggagccggagctacgatactactgggtg
gcgtggcgtgagaagacgggaccgcccgttaggaacaccttcatgcggtatcttaacctc
gcgaaccaggcagccgagcagcacggattccacgatgcgggagagcagatgcgctcggta
tatgaggatggggactttttcttcaccgtcaatgatctctggggacagctgcagccactg
tacaagcagctgttcacgttcgtccgcaaggggctgatccgtcagtacggggagcacgtg
atccgacgggaaggtccactgcccgcccatttgctcggtaacatgtggggtcaaaattgg
cgccacatcatggacatcatcaagccgggaccgcccgaaacaccggacgtgtcgggcgag
atggtgcgccagggctacacgccgatgaaaatattccaaacggcggaagagttctttacc
tccatcgggctgtcaccgatggcgccggagttttggcgcaattccgtgctgcagaaaccg
aatgacggtagcgggcagtgcagtgcttcggcctgggatttctgcaacaaggtggacttt
cgcatcaaacagtgcacgcaggtgtcgttggacgatttcgtcggagcgcaccatgagatg
acgcacattcagtactacatgcagtacgccggccaaccgtacctgtaccgggaggggccg
aatcctgcgtttcacgaagcgctggccaatgcgattacgctgagtgtcggcgggccggcg
catttgcagaagatcgggctgcttaacagcccggtcacggtggcgaacgggaacagtatg
gttaatatcgagtatctgttgaacctggcgctggataagctgccttttatggcgttcagt
ttggcactggaaaagtggcgttggtatgtgttcgaaaagggcccggtcggtatgaatgca
cgctggtgggagctacggttgcgctaccagggagtaatacctccaactgggcgtggattc
gaacactttgatgctggggcaaagtatcacgtgatatctgatcaggactacatcaagtat
ttcgtggcgaccgtgctgcagtttcagatttactccgagctttgccaagcggcacaacat
ttcgggccgcttcacacgtgcgatatctatcgatcacgtgaagcaggtcgaattttaagc
gatgttatgcaacaaggtgcgtccctatcatcggctcaactgataaaactgctaacacgt
gggaaatcgtcgcggctgtccgtggatccattgttggagttcttccgtccactggaagca
tggttggaagcacagaatcgcgatgagcaggcaagatatgacagtgcatttcctcctcta
attagccattaa

DBGET integrated database retrieval system