KEGG   Archangium gephyra: AA314_00068Help
Entry
AA314_00068       CDS       T03948                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
age  Archangium gephyra
Brite
Enzymes [BR:age01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AA314_00068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(81160..81744)
Genome map
AA seq 194 aa AA seqDB search
MPFSLPELPYKKDALAPHISAETLEYHHGKHHAAYVNNLNKLLEGKPEANSSLEQVILHS
EGGVFNNAAQVWNHTFYWNCMKPNGGGLPTGDLADAIKRDFGSFERFREEFANAATTQFG
SGWAWLVLEKGKLAVTKTGNADLPMKHGQKALLTIDVWEHAYYIDFRNARPKYIDTFLTS
LVNWDFVLQNLKGG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgccgttctcgctgcccgagctgccctacaagaaggacgccctcgccccccacatcagc
gcggagacgctcgagtaccaccacggcaagcaccacgccgcgtacgtgaacaacctcaac
aagctgctcgagggcaagcccgaggcgaacagctcgctcgagcaggtcatcctccacagc
gagggaggcgtcttcaacaacgccgcccaggtgtggaaccacaccttctattggaactgc
atgaagccgaacggcggcgggctccccacgggggacctcgcggatgccatcaagcgcgac
ttcggctcgttcgagcgcttccgtgaggagttcgccaacgccgccacgacgcagttcggc
tcggggtgggcctggctcgtgctcgagaagggcaagctcgcggtgaccaagacgggcaac
gcggatctgccgatgaagcacggccagaaggccctgctcaccatcgacgtgtgggagcac
gcgtactacatcgacttccgcaacgcgcgccccaagtacatcgacacgttcctcaccagc
ctcgtgaactgggacttcgtcctccagaacctcaagggcggctga

DBGET integrated database retrieval system