KEGG   Archangium gephyra: AA314_04986Help
Entry
AA314_04986       CDS       T03948                                 

Definition
(GenBank) Malonyl CoA-acyl carrier protein transacylase
Organism
age  Archangium gephyra
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6193716..6208418)
Genome map
AA seq 4900 aa AA seqDB search
MTSFATLVDILRTRATQTPGRTAYTFLMDGESEAVSLTYAELDRRARAIAANLQEAGAAG
QPALLLFPPGLEYVAAFWGCLYAGAMAVPAYPPDPMRLGRTLPRLQAIIADSRTRVALTT
RAILDFSEMVFAEAPELRALNWVATDEVSASGEDAWRAPGLDRSTLAFLQYTSGSTSTPK
GVMLTHGNLLENERMIQSAFEHDERSVVVGWLPLYHDMGLIGNMLQPLYVGVPCVLMSPM
DFLQKPLRWLQAISTYRATTSGGPNFAYDLCVRKISPAERETLDLRSWTLAFSGAEPVRR
DTLDRFVEAFGPCGFRREAFYPCYGLAEATLIVSGGRKAEPPLVRGFDTRAMARDSAVPS
SAPDAQPLVGCGQALPSERITIVDPATLAPCAPGKVGEIWVAGPHVAQGYWNRPQETEAA
FRATLPGGDGPYLRTGDLGFLDGGELFVTGRLKDLIIIRGANHYPQDIELTLERAHAAVR
PGCSAAFAVEANGEEQLVLVAEVDTRREPDTDALSAALRDAVARGHDLTAHAVVLLPPGS
IPKTSSGKIQRRECRAGFLAGTLPALATSTLQRAGAAPAETKADATDFAAYLREVLASAL
RMPAAQVRTDLAPAALGLDSLAAVDVQHRLDEDHGVTLPAAALLQAPSVDALARELQAAK
AARAEEPALSRGETTSERALSFAQERMFFADQLEPGGTLYNVPASLRLKGRLDATALGRA
LGEVLRRHEPLRTTVRVVEGHPVGHLQPAGNFDLPLESLEHLAPREREAEVERHVREDAR
RAFDLEHGPLLRARLLRLSAEDHALVLTLHHIACDGWSMGVLLRELSALYTAFAAGAASP
LPEPRLQYTDVTEWQRRRLEGGLLERQLAFWREQLRGAPTVLELPTDRPRTAASTRRGGR
RTFKIPAFVTDALHGLGRRAAVTPYVTLLAAFDVLLSRYTRQSDVVVGAPVANRARAQSD
KLIGLFVNTVACRVELSGDPTFRELLGRARDAVLGAMANQDAPFERVVEAVGAPRLAGRM
PLVQVMLSFENVRLPELKLGDVQARRLEADTGAAQFDLAVDLEPAGEGISGAVEYSADLF
DAGTIDRMMVQFVTLLEAAVRDPDAPISQLPLLREGDKRRLLDTWAGPRTPLQPDLTLTR
RFEEQVDRTPDAPALVFQDKRLSYRELDERANRLAHELRAQGVGPDVLVALLLEPSLETV
VGILGVMKAGGAYVPLDPSHPATRLASMLADSGAAVVLTQQALAAAAASHPRVLRMDLEA
DQARLAERPASRLAPGTVGENLAYVMYTSGSTGAPKGVMVPLRGVANLVEVMARAYGGPG
KRILQGAALTFDTSVEEIFVALLSGATLFLAPRETLLPGPDLVRLLREQRITALNETASV
LALLPSEGLPDLEAVITGGELCTADIVARWQPGRKFINVYGQTETTIEVTTAECVPGGEP
PLGRPMQNTRLYLLDDALEPVPEGVPGEAYVAGEGMGRGYFGRPDLTADRFLPDPFSYEP
GARMYRSGDLLRYTRDGRLEFLGRVDEQVKIRGIRTEPAEIAAALRRCAGVTEAAVVLRE
DGARGPMLAAYVVPAAGATLDAAELRRQLEQVLPDHMVPGAYAFLASLPLTTNGKLDRRA
LPEPTLTVEPERAYVAPRTPVEEILAGLWRELLGVERAGVEDDFFELGGHSLLATRLVAR
MRAALGVELPLRALFEDPTIAGLARRASEALGSAVPPVERAPRDGDRRELSFGQERLWFV
DRLEPGSTAYNLAGAVHLRGSLDREALVRGVREVVRRHEALRTYFREEQGRPVAVVAPEV
TLEIPSLDLRGLPPGEREAEVSRLAREEAARPFDLGAAPMLRCRLLELSEREHVLLIAMH
HIATDGWSTELFVRELAALYGAFLEGNPSPLPELALQYGDFAAWQRRWLSGGELERQLSF
WKRELSGAPDVLPLPSDRPRPPVRTSRGSTATFRVPAPVTRGLKELARREGATLFMTLLA
GYQALLARYSGQDDVVVGTPIAGRRGVEVEGLIGFFINQLALRADLSGNPTFREALGRVK
QRALSAFAHQDVPFEQVVDALAPARDSSFSPVVQVGFAYLNYPEESFSLPGLSLSIEELE
RGAKLDLTLELREEGEGLYGVLTYSTDLFERETVEGLARHLTALLAGVAAAPDTRLSALP
LLPDEERRQVMVDWNATARERAPEGTVASLFEAQAARTPDAPAVTCEGRTLSYRELDARA
SELSRALRELGVGPDARVGLCAGRSAEAVVGLLGVLKAGAAYVPLDPALPRERLAYMLED
SGASVLVTESRHADALPPARHVLWLDRPLPAPGPTEPRATPPSEQGLAYVIYTSGSTGRP
KGVAVEHRQIVHYVRGIVERLSLPEGASYGLISTLAADLGHTSLYPSLCTGGCLHLLSEE
RARDPRALAAYLREHPVDVLKIVPSHLEALLGAEDARDVLPRARLVLGGEPFPWELVERV
RALAPGLAVFNHYGPTETTVGVTTYPVDGARPGSATVPIGRPNPDTRLYVLDRWMNPVPP
LVPGELYIGGRGVARGYGARPDATAERFVPDPFSAEPGARLYRTGDLVRQLRHGAVEFLG
RIDQQVKIRGFRVELGEIEAALRAQPGVGAAVVVAREDRPGDKRLVAYVTPEGAPRAAAE
LASALRRQLPDYMVPGAFVWLDALPLSPNGKVDRRRLPAPAATPEDSAPEVFRTPAEQAL
AAIWSEVLECGPVRRTDNFFERGGHSLLAIRVLTRVQQVFGVQLPVRVLFQEQTLERQAQ
AVDAAMRTRAGTALPPLEARPAQGPTPLSFAQERLWFLDRLEPDSTSYNMPAVVRLDGPL
DVAALERALSEVLRRHEVLRAFFVEQQGRPAQGVRPHAPLELPVVELPRAEAERAAGEEL
RRPFKLDEGPLLRARLFRVGAEEHLLAVAMHHIVSDGWSLGVIVRELAALYEAFTRGAPS
PLPELPLQYSDFARWQRDWLQGEALDTELRYWKERLAGAPASIDLPTDRPRPAVLRYNGA
FRPVRVPAALTTALESLGRREGATLFMTALAAFNVLLSRYSGQRDVCVGTPVAGRDHVGT
EGLVGFFVNTLVLRTDLSGTPGFRQLVSRVRESALGAYSHRTLPFGKLVEALNPARDTSR
SPLFQVMFTLDTSPVRDVRLGQVRMRPSPVVDTGAAQFDLSLDLDTVDGELIGRLEYNTD
LFDGSTIDRMVGHLLSLLEEVTRAPDAPMDRLAMVRGAERRTLLRDWNNTAAPQAAGEWI
HERIATQAALTPDAVALQFEGTHLTYRELDERSNRLAHHLRSLGVREEDRVGLFLERSLE
LLVGILGTLKAGAAYVPLDPSYPKDRLDYMRERAGLRALLTQEKLAPRLDAPGVPVMRLD
ADEALLSAWPTHAPEVTLHGDNLAYVIFTSGSTGQPKGAMNNHRAIKNRLEWAQARHKLT
PEDRVLQKTPFSFDVSVWELIWPLMVGARLVIAPPGAHQDSRELARIITRDGITLTHFVP
SMLRLFLDEPEAARCTGLRGVICSGEALPADLAERFHQRLGAELHNLYGPTEAAVDVTAW
QCHPGDRRVNVPIGKPISNVGMYILDGALEPVPAGVQGDLYIGGVALARGYVGRPDLTAE
RFIPDPHATEPGARLYLTGDRARYLPDGNIEFLGRADHQVKLRGLRIELGEIDLALAEHP
SVAEAVVLVRPNQAGEPILAAYVVPSGEAPDVGALRAHLEARLPPYMVPAAFMFLAEMPK
NPNGKLDRRVLQAMEPLSPTGPVTAPRTPIEQLVAGVWSAVLGHEHIGVEQGFFDLGGHS
LMATQVVARLRDALGVEVPLRALFEAPTLARFSARVEELSRGLRRAADLPLLPVARPDGQ
APLSFSQERLWFLEQLVPDTAVFNLGGAVRMRGPLDPVALERAIQGVVRRHEVLRSRFIE
VDERPVQVVEPQAHVPLPLVDLSGVAPERREAEVETRMREEACRTFDLTRAPLLRLTLLR
CAEEQHVLCVSMHHIISDGWSIELFVREVAALYDAQRSGVEAALEPMALQYGDFAHWQRQ
WLGGEQLASQLQYWKEHLTGALPYLDLPTTHRRPPVQTFHGAEATFVIPPALWDGVRELS
RRAGVTPFMTLFAAFNVLLSRYARQSDVVVGISVANRTRAAMENLIGCFINVLAVRTDLS
GTPSFLELLGRVRTGLLGAYAHQDIPFERLVAELKPPRDLSRTPIFQVMFDLKNFDRSAL
ELEGLELELVEIDRGSAKYDLTLGMKEGPEGLVGHWEYNTGLFDTDTIARMAGHLHGLLE
ALVARPETRVDAPPLLSAEERQQVLAWSGPDRRFEPRECLPQRFERQVEREPAAIALVDG
ERRYRYDELNRRANQLAHALRRRGVGPDTLVGLYTERSADTVVGLLAILKAGGAYVPLDP
AYPPDRVEMMLEDSGARVLLTQRALTGQLSRPPPEVLLLDDEASFTGPADNPAPVASPEN
LAYVIYTSGSTGRPKGVPVTHANVARLFDATDRWFRFDERDVWTLFHSYAFDFSVWEIWG
ALLYGGRLVVVPAHVARSPSDFYGLLCREQVTVLNQTPSAFQHLITADEAATPLQALALR
LVIFGGEALELGSLKRWYERHDDWAPRLVNMYGITETTVHVTYRPISALEIRQPIASVIG
APIPDLRIYILDEHLQPVPVGVPGEIHVGGAGLARGYLHRPELTAQRFVPDPFSAVPGSR
LYRSGDLARFLSNGDVEYLGRADHQVKIRGFRIELGEIEAALAREPSLRTSVVLVREDTP
GDKRLVAYAVPAGERPSVAELHASLRKRLPDYMVPTFVFLDALPLTSNGKVDRRALPVPN
SERAADESFVEAANPTEEMVAKMFAEVLRVARVGTRDNFFELGGHSLLAAQLVTRLKKTF
QVEVPLRTLYESPTVEEIALTIEMMLMDEIEKSESGGDGT
NT seq 14703 nt NT seq  +upstreamnt  +downstreamnt
atgacttccttcgccaccctcgtcgacatcctccggacccgcgccacccagacccccggc
cgcaccgcctacacgttcctgatggacggcgagtcggaggcggtctccctcacctatgcc
gagctggaccggcgggcgcgcgccatcgccgcgaacctccaggaggccggcgccgctggt
cagcccgcgctgctgctgttcccgccggggctggagtacgtggccgccttctggggatgc
ctctacgcgggcgccatggccgtgcccgcctatccgccggatcccatgcggctgggccgc
accctgccccggcttcaggccatcatcgccgactcgcgcacccgggtggcactcacgacg
cgggccatcctcgacttctccgagatggtgttcgccgaggcgcccgagctgcgcgcgctg
aactgggtggccaccgacgaggtctccgcgagcggagaggacgcctggcgcgcgccgggg
ctggaccgctccacgctcgccttcctccagtacacctcgggctccaccagcacgcccaag
ggcgtcatgctgacgcacggcaacctgctggagaacgagcggatgatccagtccgccttc
gagcacgacgagcgctccgtcgtggtgggctggctgccgctgtaccatgacatgggactc
atcgggaacatgctccagccgctgtacgtgggcgtgccgtgtgtcctcatgtctccgatg
gacttcctgcagaagccactgcgctggctccaggccatctccacctaccgcgccaccacc
agcggcgggcccaacttcgcctacgatctgtgcgtgcggaagatctcccccgccgagcgg
gagacgctggacctgcgcagctggacgctggccttctccggcgcggagccggtgcgccgc
gacacgctggatcgcttcgtggaggcgtttggcccgtgcggcttccgccgcgaggcgttc
tacccctgctacggcctggccgaggccaccctgatcgtcagcggtggccgcaaggcggag
ccgccgctggtgcgcggcttcgacacccgggccatggcgcgtgacagcgccgtcccctcg
agcgcgcccgacgcacagccgctggtgggctgtggccaggcgctcccgagcgagcgcatc
accatcgtggaccccgccacgctcgcgccctgcgcgcctggcaaggtgggggagatctgg
gtcgcgggcccgcacgtggcccagggctattggaaccggccgcaggagaccgaggcggcc
ttccgcgccaccctgcccggcggagacggcccgtacctgcgcaccggggacctgggcttc
ctcgacggcggcgagctgttcgtcaccggccggctcaaggacctcatcatcatccgcggc
gcgaaccactacccgcaggacatcgagctgacgctggagcgtgcccacgcggcggtgcgc
cccggttgcagcgccgccttcgcggtggaggcgaacggcgaggagcagctcgtcctcgtg
gcggaggtggacacccgccgcgagccggacaccgacgccctcagtgccgccctgcgcgac
gcggtggcccgtgggcacgacctcaccgcccacgcggtggtgttgctgccgcccggcagc
atccccaagacctccagcggcaagatccagcgccgcgagtgccgcgccggcttcctcgcc
ggcaccctgcccgcgctcgccacctccacccttcagcgcgccggagccgctcccgccgag
acgaaggcggacgccacggacttcgccgcctacctgcgcgaggtcctcgcctccgcgctg
cgcatgcccgccgctcaggtccgcacggacctggcgcccgcggcgctcggcctggactcg
ctggccgcggtggacgtgcagcaccggctggacgaggaccatggcgtgacgttgccggcg
gcggcgctgctccaggcgcccagcgtggacgcgctcgcgcgggagctccaggcggcgaag
gccgcacgagccgaggagcccgccctctctcgcggcgagaccacctccgagcgcgcgctg
tcgttcgcgcaggagcgcatgttcttcgcggatcagctcgagccgggtggcacgctctac
aatgtgcccgcctcgctgcgcctgaagggccggctggacgcgaccgcgctggggcgcgcg
ctgggcgaggtgcttcgccggcacgagccgctgcgcaccacggtgcgcgtggtggagggc
cacccggtgggccacctccagccggcggggaacttcgacctgccgctggagagcctggag
cacctggcgccccgcgagcgcgaggccgaggtggagcggcacgtgcgcgaggacgcgcgg
cgggcgttcgacctggagcacgggccgctgctgcgggcccggctgctgcggctgtcggcc
gaggaccacgcgctcgtcctcacgctgcaccacatcgcctgcgacggctggtccatgggc
gtgctgctgcgtgagctgtccgcgctctacacggcgttcgccgctggcgccgcctccccg
ctgcccgagccgcgcctccagtacacggacgtaacggagtggcagcggcggcggctggaa
ggcgggctgctggagcggcagctcgcgttctggagggagcagctccgcggcgccccgacg
gtgctggagcttcccacggatcgtccccgcaccgcggcgtccacccggcgtggcggcagg
cggacgttcaagatccccgccttcgtgacggacgccctccacgggctgggccgccgcgcc
gccgtcacgccgtacgtcacgttgctggccgccttcgacgtgctgctgtcgcgctacacc
cggcagagcgacgtggtggtgggcgcgccggtggccaaccgcgcccgcgcgcagtcggac
aagctcatcggcctcttcgtcaacacggtggcgtgccgcgtggagctctccggtgatccc
accttccgcgagctgctggggcgggcgcgcgacgcggtgctgggcgccatggcgaaccag
gacgcgccattcgagcgcgtggtggaggccgttggagcgccgcgcctggcgggccggatg
ccgctggtgcaggtgatgctctcgttcgagaacgtgcgcctgccggagctcaagctgggc
gacgtgcaggcccggcggctggaggcggacaccggcgcggcgcagttcgacctcgcggtg
gacctggagccggctggcgagggcatctccggcgcggtggagtacagcgcggacctgttc
gacgcgggcaccatcgaccggatgatggtccagttcgtcaccctgctggaggcggcggtg
cgcgaccccgacgcccccatcagccagctgccgctgctgcgcgagggcgacaagcgccgg
ttgctcgacacctgggccgggcctcgcacgccgctccagcccgatctgacgctgacgcgc
cgcttcgaggagcaggtggaccgcacgcccgacgcgcccgcgctggtgttccaggacaag
cgcctgagctaccgggagctggacgagcgtgccaaccggctcgcccacgagctgcgcgcc
cagggcgtgggccccgacgtgctcgtggcgctgctgctggagccgtccctcgagacggtg
gtgggcatcctcggcgtgatgaaggccggcggcgcctacgtgccgttggatccgtcacac
ccggccacccggctcgcgtccatgctggcggacagcggcgccgcggtggtgctgacgcaa
caggcgctggcggcggccgccgcgtcgcaccctcgcgtgctgcggatggacctggaggcg
gaccaggcacgcctcgcggagcgcccggcctcgcgcctggcgcccggcaccgtgggtgag
aacctcgcctatgtcatgtacacgtccggctccaccggcgcgcccaagggcgtgatggtg
cccctgcgcggcgtggccaacctggtggaggtgatggcgcgcgcctacggcggtccgggc
aagcgcatcctccagggtgccgccctcaccttcgacacctcggtggaggagatcttcgtc
gcgctgctgtccggggccacgctgttcctggcgccccgcgagacgctgctgcccggcccc
gatctggtgcggctgctgcgcgagcagcgcatcaccgcactcaacgagacggcgtccgtg
ctggcgctgttgccgtcggaggggctgcctgacctggaggcggtcatcaccggcggcgag
ctgtgcacggcggacatcgtcgcgcgctggcagccgggccggaagttcatcaacgtctac
ggccagaccgagacgaccatcgaggtcaccaccgccgagtgcgtgcccggaggcgagccg
ccgctcggccgccccatgcagaacacgcggctctacctgctggacgacgcgctggagccg
gtgcccgagggcgtgcccggcgaggcgtacgtggcgggcgagggcatgggccgcggctac
ttcggccggccggacctcaccgccgatcgcttcctgccggacccgttctcctacgagccg
ggcgcgcgcatgtaccgctccggagatctgctgcgctacacgcgcgacggccggctggag
ttcctcggccgcgtggacgagcaggtgaagatccgcggcatccgcaccgagcccgccgag
atcgcggcggcgctgcgccggtgcgccggggtgaccgaggccgccgtcgtgctgcgcgag
gacggtgcgcgcggccccatgctggccgcctacgtggttccggccgccggggccacgctg
gatgcggcggagctgcggcgccagctcgagcaggtgcttccggaccacatggtgccgggc
gcgtatgcgttcctcgcgtcgctgccgctcaccaccaacgggaagctggaccgccgtgcg
ctgcccgagcccaccctcaccgtggagcccgagcgcgcctatgtggcgccgcgcacgccg
gtggaggagatcctcgccggcctctggcgcgagctgctgggagtggagcgcgccggggtg
gaggacgacttcttcgagctgggcgggcactcgctgctggccacgcggctggtggcgcgc
atgcgggcggcgctgggcgtggagttgccgctgagggcgctgttcgaggatcccaccatc
gccgggctggcgcgccgtgcctcggaggcgctggggtccgcggtgccgcccgtcgagcgc
gcgccgcgcgacggagaccggcgagagctgtccttcggccaggagcggctgtggttcgtg
gaccggctggagccgggaagcaccgcgtacaacctggccggcgcggtgcacctgcgcggg
agcctggatcgcgaggcgctggtgcgcggcgtccgcgaggtggtgcgccgccacgaggcg
ctccgcacgtacttccgtgaggagcagggccgtccggtggcggtggtggctcccgaggtg
acgttggagattccctcgctcgacctgcgcgggctgccgccgggcgagcgcgaggcggag
gtgtcgcggctggcgcgtgaggaggcggcccgcccgttcgacctgggcgccgcgccgatg
ctgcgctgccggctgctggagctgagcgagcgcgagcacgtgctgctcatcgcgatgcac
cacatcgccacggacggctggtccaccgagctgttcgtgcgcgagctggcggcgctctac
ggcgcgttcctggagggcaatccctcgccgctgccagagctggcgttgcagtacggcgac
ttcgccgcgtggcagcgccgctggctgtccggcggggagctggagcggcagctctccttc
tggaagcgcgagctctccggcgcgcccgatgtgctcccgcttccctcggatcgcccgcgg
ccgccggtgcggacgagccggggctccaccgccaccttccgcgtgccggccccggtgacg
cgcggcctgaaggagctggcgcgccgagagggcgccacgctgttcatgacgctgctggcc
ggctaccaggcgctgctggcgcggtactcgggccaggacgacgtggtggtgggcacgccc
atcgcgggccgccgaggcgtggaggtggaggggctgatcggcttcttcatcaaccagctc
gcgctgcgcgcggacttgagcggcaaccccaccttccgtgaggcgctggggcgggtgaag
cagcgcgcactgagcgcgttcgcccaccaggacgttcccttcgagcaggtggtggacgcg
ctcgcgcccgcgcgcgactccagcttcagcccggtggtgcaggtgggcttcgcctacctc
aactacccggaggagtcgttctcgctgcccggcctgtcgctgtccatcgaggagttggag
cgcggggcgaagctggacctgacgctcgagctgcgcgaggagggcgagggcctgtatggc
gtgctcacctacagcaccgatctgttcgagcgcgagacggtggagggcctcgcgcgccac
ctgacggcgctgctggcgggcgtggcggcggcgccggacacccgcctgtcggcactgccc
ctgctcccggacgaggagcggcgccaggtgatggtggactggaacgccaccgcgcgcgag
cgggcccccgagggcaccgtggccagtctcttcgaggcccaggcggcgcgcactccggac
gcaccggcggtgacgtgcgagggccgcacgctcagctaccgcgagctggacgcacgcgcg
agcgagctgtcgcgggcgctgcgcgagctgggcgtgggcccggacgcgcgcgtgggcctg
tgcgccggacgctcggcggaggcggtggtgggcctgctgggcgtgctgaaggcgggcgcc
gcgtacgtgccgctcgatccggcgctcccgcgcgaacggctcgcgtacatgttggaggac
tcgggcgcctcggtgctcgtcaccgagtcgcgccatgccgacgcgctgccgcccgcccgc
cacgtgctgtggctggaccggccgctcccggcgcccggcccgaccgagccgagggctacc
ccgccctccgaacagggcctcgcctacgtcatctacacctccggctccaccggccgcccc
aagggtgtcgccgtggagcaccggcagatcgtccactacgtgcggggcatcgtggaacgg
ctgagcctgccggagggcgcctcctacggcctcatctccaccctcgcggcggacctcggc
cacacctcgctctacccctcgctgtgcaccggcggctgcctgcacctgctctccgaggag
cgggcgagggatccgcgcgcgctcgccgcgtacctgcgcgagcacccggtggacgtgctg
aagatcgtcccctcgcacctggaggcgttgctgggcgcggaggacgcgagggacgtgctg
ccgcgcgcccggctggtgctcggcggtgagcccttcccgtgggagctggtggagcgcgtg
cgcgcgctggccccggggctcgcggtgttcaaccactacggccccaccgagacgacggtg
ggcgtcaccacgtacccggtggatggcgcgcggccgggctccgccacggtgcccatcggg
cggcccaacccggacacgcggctctacgtgctggaccggtggatgaacccggtgccgccg
ctggtgccgggcgagctgtacatcggcggccggggcgtggcccgcggctacggcgcgcgt
cccgacgccaccgccgagcgcttcgtgccggatccgttctccgccgagccgggcgcgcgg
ctgtaccgcaccggagacctggtgcgccagctgcgtcacggcgcggtggagttcctcggc
cgcatcgaccagcaggtgaagatccgcggcttccgcgtggagctgggggagatcgaggcg
gcgctgcgtgcgcagccgggcgtgggcgccgcggtggtggtggcgcgcgaggatcgcccc
ggagacaagcggctggtggcatacgtgacgcccgagggggcgccgcgcgcggcggccgag
ctggcctcggccctgcgccgccagctccccgactacatggtgccgggcgcgttcgtgtgg
ctggacgcgctgccgctgtcgcccaacggcaaggtggatcgccgccggctgcccgccccc
gccgccacgccggaggacagcgctcccgaggtgttccgcacaccggcggagcaggcgctc
gccgccatctggagcgaggtgctggagtgcggcccggtacggcgcacggacaacttcttc
gagcggggcggccactccctgctggccatccgggtgctcacccgcgtgcagcaggtgttc
ggcgtgcagctgccggtgcgagtgctgttccaggagcagacgctggagcggcaggcccag
gcggtggacgccgcgatgcgcacccgcgcgggcacggcgctgccgccgctggaggcacgc
cccgcgcagggccccacgccgctgtccttcgcccaggagcggctgtggttcctggaccgg
ctggagccggacagcacctcgtacaacatgccggccgtcgtccggctggacgggccgctg
gacgtcgcggcgctggagcgcgccctctccgaggtgctgcggcgccacgaggtactccgc
gccttcttcgtggagcagcagggccggcccgcgcagggagtgcgtccgcacgcgccgctc
gagctgccggtggtggagctgccccgcgccgaggccgagcgtgccgctggcgaggagctg
cgccgcccgttcaagctggacgagggcccgctgctgcgcgcccgcctcttccgcgtcggc
gcggaggagcacctgctcgccgtcgccatgcaccacatcgtctcggacgggtggtcgctg
ggcgtcatcgtgcgcgagctggccgcgctctacgaggccttcacgcgcggcgcgccgtcg
cccctgccggagctgccgctgcagtactcggacttcgcgcgctggcagcgcgactggctc
cagggcgaggcgctcgacacggagctgcgctactggaaggagcggctcgcgggcgcaccc
gcctccatcgacctgcccacggacaggccccggcccgcggtgctccgctacaacggcgcc
ttccggccggtgcgggtgcccgccgcgctcaccaccgcgctcgagtcgctgggccggcgg
gagggagccaccctgttcatgacggcgctcgccgccttcaacgtgctgctgtcccgctac
agcggccagcgggacgtgtgcgtcggcacgccggtcgccgggcgggaccacgttggcacg
gaggggctggtcggcttcttcgtcaacacgctggtgctgcgcacggacctctccggcacg
cctggcttccgccagctcgtctcgcgcgtgcgcgagtccgccctgggcgcctacagccac
cgcaccctgcccttcggcaagctggtggaggcgctcaacccggcgcgcgacaccagccgc
tcgccgctgttccaggtgatgttcaccctggacacctcgccggtgcgcgacgtccgcctg
ggccaggtgcgcatgcgcccctccccggtggtggacaccggtgccgcccagttcgacctc
tcgctggacctcgacacggtggacggcgagctcatcggccggctcgagtacaacaccgac
ctgttcgacggctccaccatcgaccggatggtgggccacctcctctcgctgctggaggag
gtcacccgtgcgccggacgcgccgatggaccggctggcgatggtacgcggggcggagcgc
cgcacgctgctgcgcgactggaacaacaccgccgcgccccaggccgccggcgagtggatc
catgagcgcatcgccacccaggcggcgctcacgccggacgcggtggccctccagttcgag
ggaacccacctcacctaccgcgagctggacgagcgctcgaaccggctcgcccaccacctg
cgctcgctgggcgtgcgcgaggaggaccgggtgggtctgttcctcgagcgctccttggag
ctgctggtgggcatcctcggcacgctgaaggccggcgccgcctacgtgccgttggatccg
tcgtacccgaaggaccggctcgactacatgcgggagcgcgctggccttcgcgcgctgctg
acgcaggagaagctggcaccgcggctggacgcaccgggcgttccggtgatgaggctggac
gcggacgaggcgctgctctccgcctggcccacgcatgcgcccgaggtgacgctccacgga
gacaacctggcgtacgtcatcttcacctccggctccacgggccagcccaagggcgcgatg
aacaaccaccgcgccatcaagaaccggctcgagtgggcccaggcgcgccacaagctgacg
cccgaggaccgcgtcctccagaagacgcccttcagcttcgacgtctcggtctgggagctg
atctggccgctgatggtgggcgcgcggctggtgatcgcccctcctggcgcgcaccaggac
agccgggagctggcacggatcatcacgcgcgatggaatcaccctcacgcacttcgtgccc
tccatgctgcgcctgttcctcgacgagcccgaggcggcccggtgcacgggcctgcggggc
gtcatctgcagcggcgaggcgctgcccgcggacctggcggagcgcttccaccagcggctg
ggcgcggagctgcacaacctgtacggccccaccgaggcggcggtggatgtcaccgcctgg
cagtgccaccctggtgaccgccgcgtcaacgtccccatcggcaagcccatctccaacgtg
gggatgtacatcctcgacggtgcgctggagccagtgcccgctggcgtccagggcgacctg
tacatcggcggcgtggcgctcgcgcgcggctacgtgggccgtccggacctgacggcggag
cgcttcatcccggatccgcacgccaccgagcccggcgcccggctgtacctgacgggcgat
cgcgcccgctacctgccggacgggaacatcgagttcctcggccgcgcggaccaccaggtg
aagctgcgcggactgcgcatcgagctgggtgagatcgacctggcgctcgcggagcatccg
tccgtggccgaggcggtggtgctggtgcgtccgaaccaggcgggggagcccatcctggcg
gcgtacgtggtgccctcgggcgaggcgccggacgtgggcgcgctgcgggcccacctggag
gcgcggctgcctccgtacatggtgccagcggcgttcatgttcctggcggagatgcccaag
aaccccaacggcaagctggaccggcgcgtgctccaggccatggagccgctctcccccacc
ggcccggtcaccgcgccgcgcacgcccatcgagcaactggtggcgggcgtgtggagcgcc
gtgctggggcatgagcacatcggcgtggagcagggcttcttcgacctgggcggccactcg
ctgatggcgacgcaggtggtggcgcggctgcgtgacgcgctgggcgtggaggtgccgctg
cgcgcgctgttcgaagcgcctaccctcgcgcgcttctccgcacgggtggaggagctgtcg
cgtggcctgcgccgggcggcggatcttccgctgctcccggtggcgcgtccggatggccag
gcgccgctgtccttctcgcaggagcggctgtggttcctggagcagctcgtcccggacacc
gccgtcttcaacctgggcggcgcggtgcggatgcgcgggccgttggatccagtcgcgctg
gagcgggccatccagggcgtggtgcggcgccacgaggtgctgcgcagccggttcatcgag
gtggacgagcgcccggtccaggtggtggagccccaggcgcacgtcccgctcccgctggtg
gacctgagtggcgttgcgcccgagcggcgcgaggccgaggtggaaacgcggatgcgcgag
gaggcgtgccgcacgttcgacctcacccgcgcgccgctgttgcggctgacgctgctgcgc
tgcgcggaggagcagcacgtcctgtgcgtcagcatgcaccacatcatctcggacggctgg
tccatcgagctcttcgtccgcgaggtggcggcgctctacgacgcgcaacgctctggcgtg
gaggcggcgctggagccgatggcgctgcagtatggggacttcgcgcactggcagcgccag
tggctgggcggcgagcagctcgccagccagctccagtactggaaggagcacctcacgggt
gccctgccctatctggacctgcccaccacgcaccgccgcccgcccgtgcagacgttccac
ggcgcggaggccacgttcgtcattcccccggcactctgggatggcgtgcgcgagctcagc
cgccgcgcgggcgtcacgccgttcatgacgttgttcgcggccttcaacgtgctgctgtcg
cgttacgcgcggcagtcggacgtggtggtgggcatctcggtggccaaccgcacgcgcgcg
gccatggagaacctcatcggctgcttcatcaacgtgctcgcggtgcgcacggatctgtcc
ggcacgcccagcttcctggagctgctgggccgcgtgcgcacgggcctcctgggcgcctac
gcccaccaggacatccccttcgagcggctggtggccgagctgaagccaccgcgggatctc
agccgcactcccatcttccaggtcatgttcgacctgaagaacttcgaccgctccgcgctc
gagctggaggggctggagctggagctggtggagatcgaccgcggcagcgccaagtacgat
ctcacgctcggaatgaaggagggtcccgaggggctggtgggccactgggagtacaacacc
ggcctcttcgacacggacaccatcgcgcggatggcggggcacctgcatggcctgctggag
gcgctggtggcccggcctgagacgcgggtggacgcgccgccgctgctctccgcggaggag
cgccagcaggtgctggcctggagcggcccggatcgccgcttcgagccgcgcgagtgcctc
ccccagcgcttcgagcgtcaggtggagcgcgagcccgccgccatcgcgctggtggacggc
gagcggcgctaccgctacgacgagctgaaccgccgcgccaaccagctcgcgcacgcgctg
cgccgccggggcgtgggccccgacacgctggtgggcctgtacaccgagcgctcggcggac
accgtcgtcggactgctcgccatcctcaaggccggcggcgcctacgtgccgttggatccg
gcctacccgcccgatcgcgtggagatgatgctggaggacagcggcgcccgggtgctcctc
acccagcgtgcgctcaccggccagctctcccgcccgccgccggaggtgctgctgctggac
gacgaggcctccttcaccggcccggcggacaaccctgctcccgtggcctcgcccgagaac
ctcgcctacgtcatctacacctcgggctccacgggcagacccaagggcgtgccggtgacc
catgccaacgtggcccgcctgttcgacgccaccgaccgttggttccgcttcgacgagcgc
gacgtgtggacgctgttccactcgtacgccttcgacttctccgtctgggagatctggggc
gcgctgctctacggcggccggctggtggtggtgcccgcgcacgtcgcgcgctcgccctcg
gacttctacgggttgctgtgccgcgagcaggtgacggtgctgaaccagacgccctcggcg
ttccagcacctcatcaccgcggatgaggccgctactccgctgcaggcactggcgctgcgg
ctggtcatcttcggcggcgaggcgttggagctgggctcgctcaagcgctggtacgagcgc
catgacgactgggcaccgcgtctggtcaacatgtacggcatcaccgagacgaccgtgcac
gtcacctaccggcccatctccgcgttggagatccgccagccgatcgccagcgtcatcggc
gcgccgattcccgacctgcggatctacatcctcgacgagcacctccagcccgtgccggtg
ggcgtgcccggggagatccacgtgggcggcgccggcctggctcgcggctacctgcaccgc
cccgagctgacggcacagcgcttcgtgccggatccgttctcggccgtgccgggctcgcgg
ctgtaccgctcgggagacctggcgcgcttcctgtccaacggggacgtggagtacctgggc
cgcgcggatcaccaggtgaagatccgtggcttccgcatcgagctgggcgagatcgaggcg
gcgctcgcgcgtgagccgtcgctgcgcaccagcgtggtgctcgtgcgcgaggacaccccg
ggcgacaagcgcctggtggcctacgcggtgccggcgggcgagcgcccctcggtggcggag
ctgcatgcgtcgctgcgcaagcggctgccggactacatggtgcccaccttcgtcttcctg
gacgcgctgccgctcaccagcaacggcaaggtggaccgccgcgcactgcccgtccccaac
agcgagcgcgccgcggacgagtccttcgtggaggcggccaaccccaccgaggagatggtc
gccaagatgttcgccgaggtgctgcgcgtggcgcgcgtgggcacgcgggacaacttcttc
gagctgggcgggcactcgctgctggccgcgcagctcgtcacgcggttgaagaagacgttc
caggtggaggtgccgctgcggacgctgtacgaatcgcccaccgtggaggagatcgcgctg
accatcgagatgatgctgatggacgagatcgagaagtcggagtccggaggagacgggaca
tga

DBGET integrated database retrieval system