KEGG   Archangium gephyra: AA314_05155Help
Entry
AA314_05155       CDS       T03948                                 

Definition
(GenBank) Malonyl CoA-acyl carrier protein transacylase
Organism
age  Archangium gephyra
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation AMP-binding_C PP-binding Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: AKJ03529
UniProt: A0A0G2ZXQ8
LinkDB All DBs
Position
6409199..6426397
Genome map
AA seq 5732 aa AA seqDB search
MSLPGQPSSATTLLELLETRASAQREQPLYTFLEEGEEQPVSYEALDLRARRIGAMLQSL
ARAGERAVLLYPPGLEYVAGFFGCVYAGLVAVPAYPPEPTRLERTLPRLRAIIRDARASV
VLTISFIREMGESLFEQAPELAALRWIATDAIDEGVEAGWQRPEATRDSLAFLQYTSGST
GDPKGVRLSHGNLLHNLSLISRAFEVRADSVGVIWLPPYHDMGLIGGILQPLYAGFHTAL
MSPLAFLRRPRLWLEALSRFGGTISGGPCFAFDLCVRKVPPSEREGLDLSRWELAFCGAE
PIRPEVMNRFAEAFAPAGFRSEAFYPCYGLAEGTLIASGGKKGEGVLVRTWEAAALERNE
AVTAVDGPGARPLVGCGKVMPEQSLLVVDPETRRVCPEGRVGEIWISGPSVAHGYWERPE
ESEAAFQATLVDGGPERFLRTGDLGVLHGGELFVVGRRKDLIILRGRNLHPQDLELTIER
SHPALRPGCGAAFSIEVEGEERLAVVYEVDSRKPWTPDEVVGAVRRSLSEAHEVQLHALV
LLEPGALPKTSSGKIQRRACKAELLAGWPRALLFWRDTDGVAQGQGAPVLEAPSNPVSVE
ELETWLVARLSARLRVRPEQLAKDVPITSFGLDSLAAVELAHELEHLGAVLRMDELLHGP
TVAALARTIFSARDAGLPSIPRRAEGAGAPLSSAQQRLWLFEQLEHGKPAYNLPSALRLV
GELDAAALKRSFTALLERHEILRATFLEADGSPRQVIASTPPPVFRLVELQAMPAPGREE
EALRLAREEASAPFDLARGPLLRVTLIRLDAREHLLVVVMHHIVSDGASFALVARELSAL
YASFAQGSSASPQPLPVQYPDYALWRRERETDAALAEPLSWWRQRLAGAPSALELPTDRP
RPPSPSYRGARVPLHLSEPLTARLETLGRGEGATLFMTLLSAFQVLLLRHSGQEDLCVGT
PVNGRDRASLEGLIGCFLDLLVLRTSLSGDPSFRELLARTRTTSLEAFAHRDVPFERIAE
SVPSSRDRSRSPLFQVLFVLLPEPGAELALPGLEARRVELDPGATAYDLTLSLAHGARGL
EGWLEYATDLFDASTVTRMAERLLVVLEAVVSDPDQRLSALPLLPEHERRQVLVDWNATR
TEYPETCVHALFTAQASRTPDAVAALCGDESLTYRELELRSNAVARRLRAAGVGPEVVVG
LCAERSLELVTGLLGILKAGGAYLPLDPSYPESRLAFMLEDSGAPVVLAHRHLVGALPSG
TQTVVLLDPPGVPERPEQAPATGVGPDNLAYVLYTSGSTGRPKGVLIPHRNLANFFTGMD
ARVGTTPGSWLAVTSVSFDISVLELLWTLARGFKVAVQGEQGALAAAPRRTPRRKPLGFS
LFYFAADDGAQQGGDRYRLLLEGARFADLHGFEAVWTPERHFHSFGGLYPNPSLTGAAIA
AVTERVGIRAGSVVLPLHHPVRVAEDWSVVDNLSKGRVGLSVAPGWNADDFVLAPERYAE
RRALALRDLDTVRRLWRGEAVSLPSGTGAPVDVRIRPSPVQRELPVWLTAAGNPETFREA
GRLGAGVLTHLLGQRWEELRERVALYREAWREAGHPGEGHVTLMLHTFVGQDLDQVRATV
EGPFRRYLSSSADLMRGLGRTFGLEPSSVQSEDLEALAQRAFDRYFEEAGLFGTPRTCRE
QVARLEALGVDEVACLIDFGVDSDTVLASLPALDALRQRSERDFRLQGQQGATVPAQIRR
HGITHLQCTPSLAQALLLEPEASGALAGLSRLMVGGEALAADLAARLRGAVGGELLNMYG
PTETTIWSSTHRVDGASGPVPIGTPIANTSLYVLDARLRPAPIGVPGELFIGGAGVARGY
HARPELTAERFLPDPFSAQAGARMYRTGDLARWRADGTVEFLGRVDHQVKIRGFRVEPGE
IEAALEKHPGVRQVVVAAREDPAGGARLVAYVIRRPEQAPSTDALRVFARRLLPEHLVPS
AIVALDAFPLTPNGKVDRKALPAPDGLREAAREYIAPRTRTEQRVAEIWSAVLGVQQVGA
GDDFFALGGHSLLAARAISRLRDAFGVELALRELFEAGTVASLAERIDALPKTASRTPAL
VPGSREGALPLSFAQQRLWFLEQLDPQNAAYNEAVTVRIDGVLDVAVLERCLLEVVRRHL
SLRTTFRAEDGKPVQVISPEARLTLARVDLTALSGAAQSEAVSRLAGEESLRPFALVSGP
PLRVSLMRLGEREHVLLVVLHHLVSDGWSLGVLVREVAALYPAFSAGQASPLPELSLQYV
DYAVWQRGWLRDEALEARLAYWRTRLAGAPQSLELPTDHPRPPVRSSQGASRHALLSPEL
SQAVKDLAHREGATPFMVLLAGFSALLSRYSGQEDLCVGTPVAGRDRTELEGLIGCFVNT
LVLRVSTAGNPSFRELLGRARETVLSAFAHQDAPFEKLVEVLQPERDLGRSPLFQVMLVL
QEDPLPELSLPGLQLRVLEQESRTSKFDLRLSLMETAAGLSATLEFSTDLFEPSTAERML
AHLRVLLKSAVHEPAQRVQELALLTPEERRRVLVAWNDTRLPREPEACLHRLIEAQVERT
PEAVAVSFEGTHLTYRELDTRANQLAHYLRERGVGPDRLVALCAERSLEMVVGLLGILKA
GGAYVPLDPEYPRERLEYMLADASAPVLLTQARLAPGLPHGDAAVVCLDSEWEAVAREST
ERPELALSGGNLAYVIYTSGSTGRPKGAMNTHAAICNRLLWMQEAYGLGAEDRVLQKTPF
SFDVSVWEFFWPLMTGARLVMARPGGHRDPAYLTGVISSERITTLHFVPSMLRHFLEAPE
LDARVSPRRVICSGEALPPDLRDLFHARLRSELHNLYGPTEAAVDVTFWACEPEDRRPLV
PIGRPITNTRMYVLDKHLRPVPPGVPGELYIGGMPLARGYWRRPELTAERFIPDPFAETP
GGRLYRTGDRARFLADGAIEYLGRLDDQVKLRGFRIELGEIESALMRHPHVRSVAVVVRE
DVPGDRRLVAYVIPAGEEPAPHSLRSFLGSSLPEYMVPSAFVPLEALPLSPSGKLDRRAL
PAPARARASSGEASVEPRDEMERRLAEIWAGVLGVERVGAHDRFFALGGDSILGLQVIAR
ARQVGLHLTVRQLFQHQTLAELALAAGAGRALGEQGPVSGPVPFTPIQRWFLERELPEAH
HFNQALLLETREPVDAALLEQALRALVVHHDALRSRVKRGETGWEQDCAAPGRELTLRRV
ELSALPESEQAAELERVAAEVQASLSLDEGLLVRAVLFDRGPARTGRLLLVIHHLAVDGV
SWRVLLEDLSSALHQLGRGEPATLPAKTTSFQVWTRRLEAHSRSEAVAAELPFWLEETAG
DVSALPRDRREGRNTPGSERTVTVTLEPEVTRTLLHELPSALRAGVDDVLLAGVARALSR
WKGQGRLLIDVEGHGREELFEDVDLSRTVGWFTALHPVRLELQDSGPEKALEAVRAARER
RAGRGLGYGLLRYLRRDEASEQLRARPSAEVCFNYLGQLDAGALGASRFGLAPESVGPSH
GAGGLRSHVLEVVARAAGGRLELSWVYSEALHARETIEALAADCAESLRALARTGASEER
YPLSPLQHGLLFQVLLEPGTEAYFEQRSWTLTGALDAAALREAWALVMERHPALRTDFRW
EGLDEPLQVVRTRVEPPWSELDWRGIPAEERAYRLETFLREDRARGFELTRAPLMRFTLI
RLGEQAHRFVWSFHHLVLDGWSLARVLSEVLEAYAALVRGESWRPPRALDFRAYIEWLGR
RRPERDEAFWRELLAGVDAPTPLPGEGEAGVAGGAGEREAVLDARTTAALQDFARRHGLT
PSTLVHGAWALLLSRYGAGEDVVFGTTLSGRPPELPGIEEAVGLFIHSLPVRVRIRSGEE
LVTWLRELQARLVELGQREHVPLARLQGWSEVPRGTPLFESLLVFENYPIDAALERGMAG
LTLGDFRPFERTHYPLTAVAVPGRELHLKLLFRSERVSADTAARLLAHWRTLLEGMVSAP
ERRLGDVALLSAAERRQVLVEWNATRTAFPREATLHALFEAQVARTPESVAVSFGEVSLT
YAELERRANRLAHRLLSLGVSRGSAVGLCVERSAELIVGVLGILKAGAAYVPLDPAYPSE
RLAWMIQDARVPVLLTQQRLRDGLSTGSARVLALDGAGEFEGLPDTAPEPSASAEDLAYV
IYTSGSTGVPKGVCVPHRAVVRLVVETDFIQLVPEDRVAQASNASFDAATFELWGALLHG
ARLVGVEREVALAPRSFATWLHEQRISVLFLTTAWFNQIATEVPDAFRGLRQLHFGGEAV
DPRPVRAVLREGPPQRLLHVYGPTESTTFASWHLVREVPEGSPTLPIGRPLANTEQYVLD
EALEPVPPGGAGELWIGGDGLAWGYLGRPELTADRFRPHPFSAEPGARLYRTGDRVRLLA
DGAVVFLGRVDTQVKVRGFRVEPGEVQAVLLKHPAVSEAAVLAREDAPGGSRRLVAYVGP
GAAQTLDTRALHRFLAERLPEYMVPSAFVVLERLPLTPNGKVDRRALPAPSEVPGEVDAS
YVAPRGPVEELLAGLFGELLGVSRVGAHDSFFELGGHSLLATRVVSRVLATFGVVLSLRE
LFEAPTVARLAERISTARQLPEAVRPPPIVPVPREGSLPLSLMQERLWLLDQLQPGTSLY
NVSWASWLEGSLHLPALERALSGLLQRHEALRTTFVLEAGEPVQRIHPQVELSLPVVDLR
ELPEAESETQALLVATEEARRPFDLARGPLLRALLLRTGETKHLLVLSLHHIISDGWSLG
VTIREFLALYEAELTGRPSPLPAPVLQPVDHAVWQRGWLRGEALETQLGYWRERLEGAPP
VLELPTDFPRPGVQRYRGASVRVQLPAELSSAFRTLCRREGVTPFMGLLAAFQLLLSRSS
GQEDVCVGSPISGRHHPGLEDLLGFFVNTLVLRTRLSPELTFRELLGRVRETTLGAYAHQ
DLPFEKLVEALQPPRSLSHAPLVQAVLALQEAPRLEGAATGLTFRPVELGTETAKFDLTL
SLTDAPEGFAGTLEYDADLFTPATAIRMMEHLRVLLEGAVADAGRRLGELPMMDAAEQRR
LLVEWNATHVDYPRDTGLAALFEAQAERTPDAVAVELGDERLTYRELDRRANQLARHLLG
RGVGPGTPVGLCVQRSMELVVGTLGILKAGGAYVPLDPTYPRERLAFMVEDTRVPVVLTQ
RALVPVLPEGGAAVVLLDEGWSEIAREPEDSPGIHVPGESLAYVMYTSGSTGRPKGVCIP
QRAVARLVLGSSFARWAPDEVFLQLAPICFDAATLELWGSLLHGARLVLFPPHTPTVDEL
KSVLDRHGVTTLWLTAALFEQISAMRPEALQGVRRLLAGGDVLPPAAVRERLSRGGVLVN
AYGPTENTTFTTCHVMEGAAPEGTIPIGQPIANTRVYVVDRQLRPVPVGVPGELLMGGDG
LAWGYLGRPELTAERFIPDPFGLEPGGRLYRSGDRVRHRADGTLEFLGRMDAQVKVRGFR
VEPGEVEEALRKHPSVAEVVVVARPDPAGGKRLVAYAVPRAGQELDSRALRTFLAERLPE
YMVPAVLMPLAALPLSPNGKVDRKALPEPEVSRPAGVEFVEPTTPLERRISELLAKVLGV
ERVGVEDHFFADLGGNSMSVVKACALLREELKRDVPATRFFEHSTVRALAASLERDGEAT
ADGQDNEVHEDRAEQRRQAFRRQGRRRDRGNG
NT seq 17199 nt NT seq  +upstreamnt  +downstreamnt
atgagccttcccggtcaaccatcctccgccaccacgctcctggaactgctcgagacgcgc
gccagcgcccaacgagagcaacccctctacaccttcctggaggagggtgaggagcagccg
gtgagctacgaggcgctggacctccgggcccggcgcatcggcgcgatgctccagtccctg
gcgcgggccggagagcgcgcggtgctcctgtatccgcccggcctggagtacgtcgcgggc
ttcttcggctgcgtctacgcgggactggtcgccgtgcccgcgtacccgccggagcccacg
cggctcgagcgtacgctcccccggctgcgcgccatcatccgcgatgcgcgcgccagcgtc
gtgctcaccatctccttcatccgcgagatgggcgagagcctcttcgagcaggctccggag
ctcgccgcgttgcgctggatagccaccgacgccatcgacgagggcgtggaggctggctgg
caacggcccgaggcgacgcgcgactcgctggccttcctccagtacacgtccggctccacc
ggcgatcccaagggcgtgcggctcagccacggcaacctgctgcacaacctgtccctcatc
tcgcgcgccttcgaggtccgggccgacagcgtgggcgtcatctggctgccgccgtaccac
gacatgggcctcatcggcggcatcctccagccgctctacgccggcttccacacggccctc
atgtccccgctcgccttcctccggcgcccccggctctggttggaggcgctctcccgcttc
ggcggcaccatcagcggcgggccctgcttcgcgttcgatctctgcgtccgcaaggtgcct
ccctccgagcgcgaagggctggacctgagccgctgggagctcgccttctgcggcgccgag
cccatccgccccgaggtgatgaaccgcttcgccgaggcgttcgcccccgccggcttccgc
tccgaggcgttctatccctgctacggcctcgccgagggcacgctgatcgcctcgggcggc
aagaagggcgagggcgtcctcgtccgcacctgggaggccgcggcgctggagcgcaacgag
gccgtgacggccgtggacggacccggcgcgcgtccgctcgtgggctgcggcaaggtcatg
cccgagcagtcgctcctggtcgtggatccggagacgcggcgggtgtgccccgagggcagg
gtgggggagatctggatctccggcccgagcgtggcccacggttactgggagcggcccgag
gagagcgaggccgccttccaggcgaccctggtggacggtggtccggagcgcttcctgcgc
acgggtgacctgggcgtgctccacggcggcgagctcttcgtcgtgggccggcgcaaggat
ctgatcatcctccggggccgcaacctgcacccgcaggatctcgagctgacgatcgagcgg
agccaccccgcgctccggccgggctgcggcgcggcgttctccatcgaggtggagggcgag
gagcggctcgcggtggtgtacgaggtggactcgcgcaagccgtggacgcccgacgaggtg
gtgggcgcggtccgccggagcctgtccgaggcgcacgaggtgcagctccatgcgctggtg
ctgctggagcccggggccctgcccaagacgtccagcgggaagatccagcgccgcgcctgc
aaggccgaactgctcgccggttggcctcgcgcgctcctgttctggcgggatacggacggg
gtggcgcaagggcagggggctcccgtgctggaggctccttccaacccggtctccgtcgag
gagctggagacctggctcgtggcccggctctcggcgcggctgcgcgtgcgcccggagcag
ctcgcgaaggatgtgcccatcacgagcttcggtctggactcgctggccgccgtcgagctg
gcccatgagctcgagcacctgggcgccgtcctccgcatggacgagctgctccatggcccc
accgtggccgcgctggcacgcacgatcttcagcgcgcgtgacgcggggctcccgtccatt
ccccgccgtgcggaaggggcgggcgcgccgctctcgtccgcgcagcagcggttgtggctc
ttcgagcagctcgagcacggcaagcccgcgtacaaccttccctccgccctccggctcgtg
ggcgagctcgatgcggcggcgctcaagcggagcttcacggcgctcctcgagcggcatgag
atcctccgggcgacgttcctcgaggccgatggctcgccccggcaggtcatcgcgtccacg
cctccgcccgtgttccggctcgtggagcttcaggcgatgcccgctccgggacgtgaggag
gaagcgctccggctggcccgggaggaggcgagtgctcccttcgacctcgcgcgcggtccg
ctgctccgggtcacgctgatccgtctggacgcacgcgagcacctgctcgtcgtggtgatg
caccacatcgtctcggacggcgcttccttcgccctcgtggcccgggagttgagcgcgctc
tacgcgtccttcgctcaggggtcctcggcctccccgcaaccgttgcccgtccagtacccc
gattacgcgctctggcgccgtgagcgggagacggatgcggctctcgcggagccgctctcc
tggtggcggcaacgcctggcgggcgcaccctccgccttggagttgcccaccgaccggccc
cgtcctccctcgccgtcgtaccggggcgcccgggttccgctgcacctctccgagccgctc
accgcccgcctggagacgttgggccgcggtgagggcgccacgctcttcatgacgctgctc
tcggccttccaggtcctgctgctgcgtcactcgggccaggaggacctctgtgtcgggact
cccgtcaatggccgcgaccgcgccagcctggaggggttgatcggctgcttcctcgatctc
ctcgtcctccgcacgtccctctccggcgatccctccttccgcgagctgctggcccgcacc
cggaccacgtcgctcgaggccttcgcccatcgcgacgtccccttcgagcgcatcgccgag
agtgttccgtcctcgcgtgaccggagccgctcacccctgttccaggtgctgttcgtcctc
ctgcccgagcccggtgcggagctcgcgctgcccggcctggaggctcgccgcgtggagctc
gatccgggtgccacggcctatgacctgaccctgtccctcgcgcacggcgccaggggcctg
gagggctggctcgaatacgccacggacctcttcgacgcctccaccgtgacccggatggcg
gaacggctgctcgtggtgctggaggctgtcgtctccgacccggaccagcggctctccgcg
cttcccttgctcccggagcacgagcggcgccaggtgctggtggactggaatgccacgcgc
accgagtacccggagacgtgcgtccatgcgctcttcacggcccaggcctcgcggacgccc
gatgcggtggccgccctctgtggcgacgagtcgctcacgtaccgggagctggagctgcgg
tccaacgcggtagcccggcggcttcgtgccgcgggcgtgggccccgaggtggtggtcggt
ctctgcgcggagcgctcactggaactggtgacaggactcctgggcatcctcaaggccggg
ggcgcctatctcccgctggatccctcgtaccccgagtcccggctcgccttcatgctggag
gactccggggctcccgtggtgctcgcgcaccggcatctggtgggcgcgctcccgtctggc
acccagaccgtggtcctcctggatccgcccggagtgcccgagcggcccgagcaggcaccc
gcgaccggcgtgggcccggacaacctcgcgtacgtcctctacacctccggctccaccggc
cgccccaagggcgtgctgatcccccaccgcaacctcgccaacttcttcaccggcatggat
gcgcgcgtgggcacgacgccgggctcctggctcgccgtcaccagcgtgtccttcgacatc
tccgtgctggagctgctctggaccctggctcgcggcttcaaggtcgccgtgcagggggaa
cagggcgcgctggccgccgctccccgccgcactccgcgccgcaagcccctgggcttcagc
ctcttctacttcgccgcggatgatggcgcgcagcaaggcggcgatcgctaccggctcctc
ctggaaggcgcgcgcttcgcggacctccacggcttcgaggccgtctggactcccgagcgc
cacttccactccttcggtgggctctatcccaacccctcgctcacgggcgcggcgatcgcc
gccgtcaccgagcgcgtgggcatccgcgccggcagtgtcgtcctcccgctgcaccacccc
gtgcgtgtcgccgaggactggtccgtcgtcgacaacctttccaaggggcgcgtgggcctg
tcggtggcgccgggctggaacgcggatgacttcgtcctcgcgcccgagcgctatgccgag
cgccgcgcactggcgctgcgcgacctggacaccgtgcggcggctctggcgcggagaggcc
gtctctcttcccagcggcacgggcgccccggtggacgtccgcatccgcccgagccccgtg
cagcgcgagctgcccgtctggctcaccgccgccggcaaccccgagacgttccgcgaggcg
ggccggctgggtgccggtgtcctgacgcacctgctcggccagcgctgggaggagctgcgg
gagcgcgtggccctctaccgcgaggcctggcgcgaggccggccacccgggcgagggacac
gtcacgttgatgctccacaccttcgtggggcaggacctggaccaggtgcgcgcgacggtg
gaggggcccttccgccgctacctgagcagctccgcggacctgatgcggggactggggcgg
accttcgggctggagccctcgtccgtccagtccgaggacctggaggcgctcgcccagcgc
gccttcgatcgctacttcgaggaggcgggactcttcggtacgcctcgcacctgccgcgag
caggtggcgcggctcgaggcgctcggcgtggacgaggtggcttgcctcatcgacttcggc
gtggactcggacacggtgctggccagcctgcccgcgttggatgccctgcggcagcgctcc
gagcgcgacttccgcctccagggtcagcagggcgcgacggtgcccgcgcagatccggcgc
catggcatcacccacctgcagtgcacgccctcgctggcccaggcgctgctgctggagccc
gaggcctccggtgcgctcgcgggtctgtcgcggctgatggtgggtggtgaagcgctcgcg
gcggacctcgcggcccggctgcgcggcgcggtcggtggcgagctgctgaacatgtacggc
cccaccgagaccaccatctggtcctccacacaccgcgtggacggggcctcgggtccggta
cccatcgggacgccgatcgcgaacacctctctctatgtcctggacgcgcggctgcggccc
gctcccattggcgtgcccggggagctgttcatcggtggcgcgggggtcgcccgcggctac
cacgcccggcccgagctgaccgccgagcgtttcctgccggatccgttcagcgcccaggcc
ggtgcacgcatgtaccggaccggagacctcgcgcgctggcgggcggatgggacggtggag
ttcctcggccgcgtggatcatcaggtgaagatccgcggcttccgcgtggagcccggtgag
atcgaggccgcgctggagaagcaccccggcgtgcggcaggtggtcgtggccgctcgcgag
gacccggccggcggtgcgcggctggtggcctacgtcatccgccggccggagcaggctccc
tccaccgacgcgctgcgcgtcttcgctcgccggctcctgcccgagcacctggtgccttcc
gccatcgtggcgctcgacgcgttccccctgacgcccaatggcaaggtggatcgcaaggcg
ctgcccgcgccggatggactgcgcgaggccgctcgggaatacatcgctccgcgcacccgc
accgagcagcgtgtggcggagatctggtccgcggtgctgggcgtccagcaggtgggggca
ggggatgacttcttcgcgctcggtgggcactcgttgctcgccgcccgcgccatctcccgc
ctgcgcgatgccttcggcgtggagctggccctgcgcgagctcttcgaggccggcaccgtg
gcctcgctcgccgagcgcatcgacgcgctcccgaagacggcttcccggactcctgccctg
gtgccgggctcccgcgagggcgcgctgcccctgtccttcgcccagcagcggctctggttc
ctggagcagctggatccccagaacgccgcctacaacgaggccgtgacggtccgtatcgac
ggggtgctcgatgtggcggtgctggagcgctgcctcctcgaggtcgtccggcgtcacctg
agcctccggaccaccttccgcgccgaggacggcaagcccgtccaggtcatctctccggag
gcccggctcacgctggcccgtgtcgacttgacggcactctccggagccgcccagtcggag
gcggtctcgcggctcgcgggtgaggagtccctgcggcccttcgcgctcgtgtcggggccg
ccgctgcgtgtctcgctgatgcgcctgggcgagcgcgagcatgtcctgctcgtcgtgctc
caccacctcgtctcggacgggtggtccctgggtgtgctggtccgcgaggtggccgcgctc
tacccggccttctccgcgggccaggcctcgcccctgccggagctctcgctccagtacgtg
gattacgccgtgtggcagcgcgggtggttgcgagacgaggccctggaggcacggctcgcg
tactggcggacccggctggcgggagcgccccagtcgctggagctgcccacggatcatccc
cggcccccggtgcgcagttcccagggcgcgagccggcatgccctcctgagccccgagctg
tcccaggccgtgaaggacctggcccaccgtgagggcgcgactcccttcatggtcctgctg
gcgggcttctccgcgttgctgtcccgctacagtggccaggaagacctctgcgtgggcacg
cccgtggccggccgcgaccgcaccgagctggaagggctcatcggctgcttcgtcaacacg
ctcgtgctccgcgtgtccaccgcgggcaacccgtccttccgcgagctgctcggccgcgcc
cgtgagaccgtgctgagtgccttcgcccaccaggacgcccccttcgagaagctcgtggag
gtgctccagcccgagcgcgacctcggccgaagcccgctcttccaggtgatgctcgtgctc
caggaggatccgctgccggagctgtccttgccgggcctccagctgcgcgtgctggagcag
gagagccgcacgtccaagttcgatctgcgcctcagcctcatggagacggcggccgggctc
tcggcgaccctcgagttcagcaccgacctcttcgagccctccaccgccgagcgcatgctc
gcgcacctgcgcgtcctcctcaagagcgccgtccatgagccggcccagcgcgtccaggag
ctggcgctgctgacgcccgaggaacgccgccgcgtgctggtggcgtggaatgacacccgg
ctgccccgcgagccggaggcgtgcctgcatcggctcatcgaggcccaggtggagcgcacg
ccggaagcggtggccgtgtccttcgagggcacgcacctcacgtaccgggagctggacacc
cgtgcgaatcagctcgcccattacctgcgcgagcggggcgtgggaccggaccggctggtg
gcgctgtgcgccgagcgatcgctcgagatggtcgtgggactgctcggcatcctgaaggcg
ggcggcgcctacgtgccgctggatcccgagtacccgcgcgagcggctcgagtacatgctc
gccgacgcatcggcgcccgtgctcctcacccaggcgcggctcgccccgggtctccctcac
ggcgatgcggccgtggtgtgtctggactcggagtgggaagccgtggcccgcgagtccacc
gagcgcccggagctcgcgctgtccggtggcaatctggcctacgtcatctacacctcgggc
tccaccgggcggcccaagggcgcgatgaacacccacgccgccatctgcaaccggctcctc
tggatgcaggaggcgtacgggctgggcgcggaggatcgcgtcctccagaagacgccgttc
agcttcgacgtctccgtctgggagttcttctggccgttgatgacgggggcccggttggtg
atggcccggcccgggggacaccgggatccggcgtacctcaccggcgtcatctccagcgag
cggatcaccacgctgcacttcgtgccctccatgctgcggcacttcctggaggcgccggag
ctggatgcccgcgtcagccccaggcgcgtgatctgcagcggcgaggccctgccgccggac
ctgcgggatctcttccacgcgcggctgcgctcggagctacacaacctctacgggcccacc
gaggccgccgtggatgtgacgttctgggcgtgcgagccggaggaccggcggcccctggtc
cccatcgggcgccccatcaccaacacgcggatgtacgtgctggacaagcacctgcgcccc
gttcctcccggtgtccccggtgagctgtacatcggcggcatgccgctggcccgtggctac
tggaggcggccggagctgaccgccgagcgcttcattccggatccgttcgcggagactccg
ggcggccggctgtatcggaccggggatcgcgcccggttcctggcggatggcgccatcgag
tacctcggccggttggatgatcaggtgaagctgcgcggcttccgcatcgagctcggggag
atcgagtccgcgctgatgcggcacccgcatgtgcgctcggtcgcggtggtggtgcgcgag
gacgtgccgggtgatcgccgcctcgtggcctatgtcatccccgctggcgaggagcccgcg
ccccactcgctgcgctccttcctggggagctcgcttcccgagtacatggtgccctcggcc
ttcgtgcccctggaggcactgccgctctcgccgagcggcaagctggatcgccgggccctg
cccgcgccggctcgtgcacgggccagcagtggcgaggcctccgtcgagcctcgcgatgag
atggagcgccggctcgcggagatctgggccggggtgctcggggtggagcgcgtgggcgcc
cacgatcgcttcttcgcgctgggcggggattccatcctcggccttcaggtgattgctcgc
gcgcggcaggtggggctgcacctcaccgtccggcagctcttccagcatcagaccctggcc
gagctggccctcgcggctggagccggccgggccctgggcgagcaggggccggtgtccggg
ccggtgccgttcacgcccatccagcggtggttcctcgagcgggagctgccggaagcgcac
cacttcaatcaggcgctgttgctggagacgcgcgagccggtggacgccgccctgctggag
caggcgctgcgcgcgctggtggtgcaccatgacgcgctccgctcgcgagtgaagcgcggg
gagacgggctgggagcaggactgcgcggccccgggacgcgagttgacgctgcgccgggtg
gagctgtccgcgctgccggagtccgagcaggccgcggagctcgagcgtgtcgcggccgag
gtgcaggccagtctgtcgctggacgaggggctgttggtgcgcgcggtgctgttcgaccgg
ggcccggcacggaccggccggctgctcctggtcatccatcacctcgccgtcgatggcgtc
tcctggcgcgtgctgctggaggacctgtcgagcgcactgcaccagctcggccggggcgag
ccggccacgctgcccgcgaagacgacgtccttccaggtctggactcggcggttggaagcg
cattcgcggtcggaggccgtcgcggcggagttgcccttctggttggaggagaccgcgggc
gacgtgtccgcgctgccccgggatcggcgggaaggacgcaacacgccgggctccgagcgc
accgtcacggtgacgctggagcccgaggtgacgcggacgctcctgcacgagctgccgtcc
gccctgcgcgccggcgtggatgacgtgctgctcgcgggagtggcccgggccctgtcgcgg
tggaaaggtcagggccggctgctcatcgacgtggaaggacacgggcgcgaggagctcttc
gaggacgtggacctctcgcgcacggtgggctggttcaccgcgctccatccggtccgcctg
gagctccaggactcgggccccgagaaggccctcgaggcggtccgtgccgcgagggagcgg
cgggcgggcagggggctcggctacggcttgctgcgctacctgcgccgggatgaagcctct
gagcagctccgcgcacggccctccgccgaggtctgcttcaactacctcgggcagctcgac
gcgggtgcgctgggcgcgtcccggttcggcctcgcgcctgaatccgtggggccctcgcat
ggggccggcggactccggagccatgtgctggaggtggtggctcgcgccgcgggcgggcgc
ctggagctgtcctgggtgtacagcgaggcgctgcacgcccgcgagacgatcgaggcgctg
gccgccgattgcgcggagtcgctccgggcgctcgcgcggaccggtgcttccgaggagcgc
tacccgctctctccgctccagcacggactcctgttccaggtgctgctggagcccgggacg
gaggcgtatttcgagcagcggagctggacgctcaccggggcgctcgatgccgccgcgctc
cgcgaggcctgggcattggtgatggagcgccaccccgcgctgcggacggacttccggtgg
gagggcctggacgagcccctccaggtggtgcggacgcgggtggagccgccgtggagcgag
ctcgactggcgcggcattccagcggaggagcgtgcgtacaggctggagaccttcctgcgc
gaggaccgggcccgtggcttcgagctgacgcgagcgcccctgatgcgcttcacgttgatc
cggttgggggagcaggcccaccggttcgtctggagcttccaccacctggtgctggacgga
tggagcctggcacgggtgctctcggaggtgctggaggcctacgcggcgctcgtccgtggc
gaatcgtggcggcctccgcgtgcgctggacttccgcgcgtacatcgagtggctgggacgg
cggcggcccgagcgggatgaggcgttctggcgcgagctgctcgcgggcgtggacgcacca
accccgttgcccggtgagggcgaagccggtgtggcgggcggggcgggcgagcgggaggcc
gtgctcgacgcgcggaccaccgcggcgctccaggacttcgcgcggcggcacgggctcacg
ccgagcacgctggtgcacggcgcgtgggcactgctgctgtcccggtacggggcgggcgag
gatgtcgtcttcggcaccacgctctcgggccgtccgccggagttgccgggcatcgaggag
gcggtggggttgttcatccactcgctccccgttcgcgtccggatccggagtggcgaggaa
ctggtcacctggttgcgcgagctccaggcgcggctggtggagctgggccagcgcgagcac
gttccgctggcgcgcctccagggctggagcgaggtgccccggggcacgccgctcttcgag
agcctgctcgtcttcgagaactatccgatcgatgccgcgctcgagcggggcatggcgggc
ctgacgctcggggacttccggcccttcgagcgcacgcactacccgttgaccgccgtggcc
gtaccgggccgcgagctgcacctcaagctgctgttccgctccgagcgcgtctccgcggac
accgccgcgcggttgctggcgcactggcgcaccctgctggagggaatggtctcggctccg
gagcggcggcttggggacgtggccctgttgtcggcggccgagcgccgtcaggtgctggtg
gagtggaacgccacgcggaccgcgttcccgcgcgaggccaccctccacgcgctgttcgag
gcccaggtggcccggacgccggagtcggtggcggtgtccttcggtgaggtctcgctcacc
tatgccgagctggagcgccgggcgaacaggctggcgcatcgcctcctgtcactgggtgtc
tcgcgaggctcggccgtgggcctgtgcgtggagcgctcggccgagctgatcgtgggcgtg
ctgggcatcctgaaggccggtgccgcctacgtcccgctggatccggcgtacccgagcgag
cgtctggcctggatgatccaggatgcccgggtgccggtgctgctcacccagcagcggctg
cgggacggtctgtcgacggggtccgcgcgggtgctcgcgctggatggggcaggggagttc
gaggggctgcccgacacggctccggagccgagcgcctcggccgaggatctcgcctacgtc
atctacacctcgggctccacgggcgtgcccaagggcgtctgcgtcccgcaccgcgccgtg
gtccggctggtggtggagacggacttcatccagctcgtccccgaggaccgtgtggcgcag
gcgtccaacgcctcgttcgatgcggccaccttcgagctctggggcgcgctgctgcatggg
gcccggctggtgggcgtggagcgtgaggtggcgctcgcgccgaggtcgttcgccacgtgg
ctgcacgagcagcgcatcagcgtcctcttcctcaccacggcctggttcaaccagatcgcc
accgaggtgccggacgccttccgagggctgcggcagctccacttcggcggcgaggcggtg
gatccccggccggtccgcgcggtcctccgcgaagggccgccgcaacggctgctccacgtc
tacggtcccaccgagagcaccaccttcgcttcctggcacctcgtgcgcgaggtccccgag
ggcagcccgacgctccccattggccggccactggccaacacggagcagtacgtgctcgac
gaggcactggagcccgtgccgccgggtggagcaggggagctgtggatcggcggagacggc
ctggcctggggttacctcgggcggcccgagttgaccgcggatcgcttccggccccacccg
ttcagcgccgagcccggagcccgtctgtaccggacgggcgatcgcgtccggctgctggcg
gacggagcggtcgtgttcctcgggcgcgtggatacccaggtgaaggtgcgcggcttccgc
gtggagccgggcgaggtccaggcggtgctgttgaagcaccccgccgtgagcgaggccgcc
gtgctggcgcgcgaggatgctcccggaggctcgcgccggctcgtggcctatgtggggccc
ggagcggcacagacgctcgatacgcgcgcgctgcaccggttcctcgcggagcggctgccc
gagtacatggtgccctccgccttcgtcgtgctggagcggttgccgctgacgcccaatggc
aaggtggatcgccgcgcgctccccgccccctccgaggtgccgggcgaggtggatgcctcc
tacgtcgctccgcgtgggcccgtggaggagctgctcgcgggcctcttcggcgagctgctt
ggcgtctcgcgcgtgggcgcccatgacagcttcttcgagctgggtgggcactcactgctg
gccacccgtgtggtgtcgcgtgtcctcgccaccttcggggtggtgctgtcgctgcgagag
ctgttcgaagcgcccaccgtggcgcggctggccgagcggatctccacggcccgccagctc
cccgaggcggtgcgcccaccaccgatcgtccccgtgccccgtgagggctccctgccgctg
tccctgatgcaggagcgcctctggctgctggatcagctccagcccggcacgtccctctac
aacgtctcctgggcctcctggctggaaggctccctgcacctgcccgcactggagcgcgcc
ctgtccgggctgctccagcgtcacgaggcgctgcggaccaccttcgtgctcgaggcgggc
gagcccgtgcagcggatccacccccaggtggagctgtccctgccggtcgtggatctccgc
gagctgcccgaggcggagagcgagacccaggccctgctcgtggccaccgaggaggcgcgg
cggccgttcgacctcgctcgcgggcccctcctccgcgcgctgctgctccgcacgggcgag
acgaagcacctgctcgtcctgtcgctgcaccacatcatctcggacggctggtccctgggc
gtgacgatccgggagttcctggcgctgtacgaggcggagctcacgggccggccctcgccg
ctgcccgcgcccgtgctccagcccgtggatcacgccgtctggcagcgcgggtggctccgc
ggcgaggcgctcgagacgcagctcggctactggcgcgagcggctcgagggcgctccgccg
gtgttggagctgcccacggacttcccgcgcccgggcgtccagcgctaccgcggtgcctcc
gtccgcgtccagctcccggccgagctgtcctccgcgttccggaccctctgccgccgtgag
ggggtcacgcccttcatgggtctgctggccgccttccagctcctcttgtcccgctcctcg
ggccaggaggacgtctgcgtgggctctcccatctccggccgccaccatcccgggctggag
gacctgctcggcttcttcgtcaacacgctggtgctgcggacccgcctctcgccggagctc
accttccgcgagctgctgggccgcgtgcgcgagacgacgctcggcgcctatgcccaccag
gatctgccgttcgagaagctggtcgaggccctccagcctccgcgcagcttgagccatgct
ccgctcgtgcaggcggtgctggccctccaggaggcaccgcggctggagggggccgccacg
ggtctcaccttccgcccggtggagctgggcaccgagaccgcgaagttcgatctcacgctc
tcgctcacggatgcgcccgagggcttcgccgggacgctggagtacgacgcggacctgttc
actcccgccaccgccatccggatgatggagcacctgcgcgtgctgctggagggcgcggtg
gccgatgcgggccggcgcctcggcgagctgccgatgatggacgcggcggagcagcggcgt
ctgctggtggagtggaacgccacccacgtggactacccgcgtgacacgggcctcgccgcg
ctcttcgaggcgcaagcggagcgcacgccggacgcggtggcggtggagctcggagacgag
cggctcacgtaccgcgagctggatcggcgcgcgaaccagctcgcccggcacctgctgggg
cggggcgtggggccggggactccggtgggcctgtgcgtgcagcgctcgatggagctggtg
gtggggacgctcggcatcctcaaggccggtggcgcctacgtgccgctggatcccacctat
ccgcgcgagcggctggccttcatggtggaggacacgcgcgtgccggtggtgctgacgcag
cgcgcgctggtgccggtgctgccggagggtggcgcggcggtggtgctgctggacgagggc
tggagcgagatcgcccgcgagcccgaggactccccgggcatccacgtgccgggcgagtcc
ctggcctatgtcatgtacacctcgggctccaccgggcggcccaagggtgtctgcatcccg
cagcgcgcggtggcgaggctcgtgctgggctcgtccttcgcgcggtgggcgccggacgag
gtgttcctccagctcgcgcccatctgcttcgacgccgccacgctcgagctgtggggctcc
ctgttgcacggcgcgcggctggtcctcttcccgccgcatacccccacggtggacgagctg
aagtccgtgctggatcgccacggggtgacgacgctctggctgacggcggcgctcttcgag
cagatctccgccatgcggccggaggcgttgcagggcgtgcggcggctgctcgcgggcgga
gacgtgctgcctcctgccgcggtgcgcgagcggctctcgcggggcggtgtgctcgtcaac
gcgtacgggcccacggagaacaccaccttcaccacctgccatgtcatggagggcgctgct
cccgagggcaccattcccatcggccagcccatcgccaacacgcgggtgtacgtggtggat
cgccagctccggcccgttcccgtcggcgtgccgggcgagctgctcatgggcggggacggc
ctggcctggggttacctcgggcggccggagctgacggcggagcgcttcatcccggacccg
ttcggcctggagcccggcgggcggttgtaccgctcgggcgatcgggtccgccaccgtgcg
gacgggacgctggagttcctcgggcgcatggatgcgcaggtgaaggtccgaggcttccgc
gtggagccgggcgaggtggaggaggcgctccgcaagcaccccagcgtcgccgaggtggtg
gtggtggcgcggccggatccggcgggcggcaagcggctggtggcctatgccgtcccacgg
gccgggcaggagctggactcgcgcgccctgcggaccttcctcgcggagcggctgcccgag
tacatggtgccggcggtgctcatgccgctggcggcgcttccgctctcgcccaacggcaag
gtggatcgcaaggcgctcccggagccggaggtgtcgcggccggccggcgtcgagttcgtg
gagcccaccacgcccctggagcggcggatttcggagctgctggcgaaggtgctcggagtg
gagcgcgtgggagtggaagaccacttcttcgcggacctgggtggcaactccatgtcggtg
gtgaaggcctgcgcgctcctgcgggaggaactgaagcgggacgtgcccgccacgcgcttc
ttcgagcactcgacggtacgagcgctcgccgcttccctggagagggacggagaagccacg
gcggacgggcaggacaacgaggttcatgaagatcgcgcggaacagcggcggcaggcgttc
cggcggcagggcaggcgaagggatcgcggaaatggatga

DBGET integrated database retrieval system