KEGG   Archangium gephyra: AA314_05311Help
Entry
AA314_05311       CDS       T03948                                 

Definition
(GenBank) peptidase M16 domain protein
Organism
age  Archangium gephyra
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M16_C Peptidase_M16
Motif
Other DBs
NCBI-ProteinID: AKJ03685
UniProt: A0A0G2ZVY3
LinkDB All DBs
Position
6647836..6649191
Genome map
AA seq 451 aa AA seqDB search
MPKAPANSAVRKADPVLQSLFDVQEATLPNGLRVRLLANHDTPVVSLYTFFQVGSRNERP
GITGISHLFEHMMFNGAKKYGPKMFDQVLESNGGRSNAYTSTDMTVYYEDFASDALETVL
DLESDRMRSLRIDDDALESERQVVMEERRVRVDNDITGTMDEELGTLIWKAHAYRWPVIG
WEKDIENISRKDCEQYFRTYYAPNNAVLYICGDIDPKKTLALVRRYYGDIPKGPKPEPVL
NAEPVQKGERRAEVRHPAQSPALMLAWHGPAARDEDTLVLDIIQYALTKGEGSRLVKKLV
YETQLAVSVMVDWGWRVDPGAIIVYLELKQDSDPRKVEEALYAELARVATEGLTERELQK
AKNNLRADHLRELATNSGRAHAMGHYEALLGSWRDGLTLPSVYAAATNEQVKAVAAKYFA
PERRSVVTLIPAPGGATDEAVDGAADGKDAE
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaggcacccgcgaactccgccgtgcgcaaggcggatcccgtcctgcagtccctc
ttcgacgtccaggaggccacgctgcccaacggtctccgcgtccgtctcctggccaaccac
gacacgcccgtggtgagcctctacaccttcttccaggtgggcagccgtaacgaacgccct
ggcatcaccggcatcagccacctgttcgagcacatgatgttcaacggggccaagaaatac
gggcccaagatgttcgaccaggtgctcgagtcgaacggtggccgctccaacgcgtacacg
tccacggacatgaccgtgtactacgaggacttcgcctcggacgcgctggagacggtgttg
gacctggagtcggaccggatgcgctcgctgcgtatcgacgacgacgcgctggagagcgag
cgccaggtggtgatggaggagcgccgcgtccgcgtggacaacgacatcaccggcaccatg
gatgaggagctgggcacactcatctggaaggcgcacgcctaccgctggcccgtcatcggg
tgggagaaggacatcgagaacatctcccgcaaggactgcgagcagtacttccgcacgtac
tacgcgcccaacaacgcggtgctctacatctgcggggacatcgatcccaagaagacgctg
gcgctggtgcgccgctactacggggacatccccaagggccccaagcccgagcccgtgctc
aacgccgagcccgtgcagaagggcgagcgccgcgccgaggtgcgccaccccgcccagtcc
ccggcgctgatgctcgcctggcacggcccggcggcgcgtgacgaggacacgctcgtgctg
gacatcatccagtacgcgctgacgaagggcgagggcagccggctggtgaagaagctcgtc
tacgagacgcagctggccgtgtcggtgatggtggactggggctggcgggtggatcccggc
gccatcatcgtctacctggagctcaagcaggactcggatccgcgcaaggtggaggaggcc
ctgtacgccgagctggcgcgtgtggccaccgagggcctgacggagcgcgagctgcagaag
gcgaagaacaacctgcgggcggatcacctgcgggagctggcgacgaacagcgggcgggcg
cacgccatgggccactacgaggcgctgctgggctcgtggcgggacgggctgacgctgccc
tcggtgtacgcggccgccacgaacgagcaggtgaaggcggtggcggcgaagtacttcgcg
cccgagcgccgctcggtggtgacactcattcccgccccgggtggggccacggacgaagcc
gtggacggagccgctgacggaaaggacgccgagtag

DBGET integrated database retrieval system