KEGG   Archangium gephyra: AA314_09308Help
Entry
AA314_09308       CDS       T03948                                 

Definition
(GenBank) Acyltransferase family protein
Organism
age  Archangium gephyra
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
11582974..11584698
Genome map
AA seq 574 aa AA seqDB search
MRTLAEAVAHWARTRPSQPLFYFADLEEKLTVLTAGDLHHNALRIAAHLHARGVRQGDKV
VLSFDTSPEFLESFFACGLVGATPCLIELPSSKVSVRAWGERLRVKLRLLEARAMLIDPD
FADLAHEALLEPAAEPGHPAPFVATVKELAGEAPSFEPPTANADDTAFIQFTSGTTDAPK
GVQISHRALFANCAAMGEISQWNSDDLMVCWLPLFHDMGLVASTLASFVHGIPTALLPPF
GFLLKPARWLWAIHYFRATSSFAPNFAYQLCVKRIKDAELEGLDLSAWERAYNAAEFIHA
DTVRHFTERFQPHGFEPDTWRPAYGMAEMVVGISIRDRNDPLRMETISRSALASKRQAVP
VHESGPDALTVLSVGRVLRGIDLRIVDDEGRELGERQEGEILLRGTSLFGGYFKNPEATG
AVLREGWLHTGDLGYLAEGQLFICGRSKDLIIKAGENHHPYTMESAAAQVTGVRAGCVAA
VGVNNLQTGTEDIVLVCETTETKHDVLRQQCKHVEEMVYQGSGVRPNRVIPVAPHTLPKT
TSGKIKRAYIRQNIEAFENLSLLVTPPARQSIVH
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
gtgcggacactcgccgaggccgtggcgcactgggcgcgcacccgtccctcgcagccgctc
ttctacttcgcggacctggaggagaagctcaccgtcctcaccgcgggggacctgcaccac
aacgcgctgcgcatcgccgcccacctgcacgcgcgcggcgtgcgccagggcgacaaggtg
gtgctctccttcgacaccagccccgagttcctcgagagcttcttcgcctgcggcctggtg
ggcgccaccccctgcctcatcgagctgccctcctcgaaggtgtccgtgcgcgcctggggc
gagcggctgagggtgaagctgcgcctgctggaagcgcgggccatgctcatcgacccggac
ttcgcggacctggcgcacgaggccctgctggagccggcggccgagccgggccaccccgcc
cccttcgtggccaccgtgaaggagctggccggcgaggccccctccttcgagccccccacc
gccaacgccgacgacaccgccttcatccagttcacctcgggcaccacggacgctcccaag
ggcgttcaaatctcccaccgcgcgctgttcgccaactgcgcggccatgggggagatcagc
cagtggaactcggatgacctgatggtgtgctggctgccgctgttccacgacatgggactg
gtggcctccacgctggcctccttcgtccacgggattcccacggcgctgctgccgcccttc
ggcttcctgctcaagccggcgcgctggctgtgggccatccactacttccgcgccacctcg
tccttcgcgcccaacttcgcctaccagctgtgcgtcaagcgcatcaaggacgcggagctc
gagggcctggacctgagcgcgtgggagcgggcctacaacgccgccgagttcatccacgcc
gacaccgtgcgccacttcaccgagcgcttccagccccacggcttcgagccggacacctgg
cggcccgcctacggcatggcggagatggtggtgggcatctccatccgcgaccggaatgat
cccttgcgcatggagaccatctcccgctcggcgctggcctcgaagcggcaggccgtgccc
gtgcacgagagcggcccggacgcgctcaccgtgctcagcgtgggccgggtgctgcgcggc
atcgatctccgcatcgtcgacgacgagggccgcgagctgggcgagcgccaggaaggcgag
atcctcctgcgcggcacctcgctcttcggtggctacttcaagaacccggaggccaccggc
gccgtgctgcgcgagggctggctgcacaccggggacctgggttacctcgccgagggccag
ctcttcatctgcgggcgcagcaaggatctcatcatcaaggccggcgagaaccaccacccg
tacaccatggagagcgccgccgcccaggtgaccggggtgcgtgccggctgcgtggccgcc
gtgggcgtcaacaacctccagacgggcaccgaggacatcgtcctcgtgtgcgagaccacc
gagaccaagcacgacgtgctgcgccagcagtgcaagcacgtggaggagatggtctaccag
ggctccggcgtgcgccccaaccgcgtcatccccgtggccccccacaccctccccaagacg
accagcggtaaaatcaaacgcgcctacatccggcagaacatcgaggccttcgagaacctc
tccctgctggtgacgcctcccgcccgtcagtccatcgtccactga

DBGET integrated database retrieval system