KEGG   Archangium gephyra: AA314_09317Help
Entry
AA314_09317       CDS       T03948                                 

Definition
(GenBank) Pyoverdine chromophore precursor synthetase PvdL
Organism
age  Archangium gephyra
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(11596193..11597947)
Genome map
AA seq 584 aa AA seqDB search
MKGPALPALKHATLNEALAAAARTPLGLVFVDAGERETLLTWAQVYGRARRFAAGLRRLG
VAPGERVALLLPTSPGFMDAFFGALLAGAVPVPLYPPVRLGRLEEYHRSTARMLEVSAAA
VVLTDAKVRLLLGASVAAARPRLGCHTVEEVSREDGDLAERVSPESLALIQFSSGSTVDP
KPVGLRQGHLMAQLAALEAELPPPVDRAPVGVCWLPLYHDMGLIGCLLSAVYYPGGMVLI
PPEVFLARPALWLRALSRHRGFVSPAPNFAYGLCLKRVKDADLEGVDLSGWTHALNGAEP
VSVETLRLFSERFSRWGFQAGSLRPVYGLSEASLAVTFPPAGRGPRALGVDARVLATERR
VVEGAREVVSVGRPVPGFEVQVRDELGHVLEERRVGRVFARGPSVMAGYVGHPEATARAL
DAEGWLDTGDLGFEADGELFLTGRAKDLVIIRGANHAPQEFEECLEAVEGLRTGCAVALG
FTPEGENDEALLVLAEHAPGAGAAGLEERIREAVLAGTGVKAHTVRVLEPGTLPRTSSGK
LRRSEALRRYLAGELTAPRKVGTVGLVVEMAKSALAFARSGRDE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcccggcgttgccggcgctgaagcacgccaccctcaacgaggcgctcgccgcc
gcggcgcggacgccgctggggctcgtcttcgtggacgccggggagcgcgagacgctgctg
acctgggcgcaggtgtatgggcgggcgcgccgtttcgccgcgggcctgaggcgcctgggg
gtggctcctggcgagcgcgtggcgttgctgttgcccacctcgccgggcttcatggatgcc
ttcttcggcgcgctgctggcgggcgcggtgccggtgccgctctacccgccggtgcggttg
ggccggctggaggagtaccaccgctccaccgcgcgcatgctggaggtgtcggcggcggcg
gtggtgctcacggacgcgaaggtgcggctgctgctgggcgcgtccgtggcggcggcgcgt
ccgaggctcggctgccacacggtggaggaggtgtcccgcgaggacggggacctggccgag
cgtgtctcgcccgagtcgctcgccctcatccagttctcctcgggctcgacggtggacccg
aagccggtggggctgcgtcagggccacctgatggcgcagctcgcggcgctggaggcggag
ctgccgccgccggtggaccgggcgccggtgggcgtgtgctggctgccgctgtaccacgac
atggggctcatcggctgcctgctgtcggcggtgtactacccgggcggcatggtgctgatt
ccccccgaggtgttcctcgcgcggccggcgctgtggctgcgcgcgctgtcgaggcaccgg
ggtttcgtctcgcccgcgcccaacttcgcctacgggctgtgcctcaagcgggtgaaggac
gcggacctggagggggtggacctgtcgggctggacgcacgcgctcaacggcgcggagccg
gtgtcggtggagacgctgcgcctcttctccgagcgcttctcccggtggggcttccaggcg
ggctcgctgcggccggtgtacgggttgagcgaggcctcgctggccgtcaccttcccgccg
gcgggacgggggccgcgcgcgctgggcgtggacgcgcgggtgctggccacggagcggcgc
gtggtggagggcgcgcgcgaggtggtgtccgtggggcgtccggtgccgggcttcgaggtg
caggtgcgggacgagctgggccacgtgctggaggagcggcgggtggggcgggtgttcgcg
cgagggccgtcggtgatggcggggtacgtgggccacccggaggcgacggcgcgcgcgctg
gacgccgagggctggctggacacgggagacctgggcttcgaggcggacggcgagctgttc
ctcacgggccgggcgaaggacctggtcatcatccgtggcgccaaccacgcgccccaggag
ttcgaggagtgcctggaggcggtggagggcctgcgcacgggctgcgcggtggcgctcggc
ttcacccccgagggagagaacgacgaggcgctgctggtgctggccgagcacgcgccgggc
gcgggagcggcgggcctggaggagcggattcgcgaggcggtgctggcgggcacgggggtg
aaggcgcacacggtgcgggtgctggagccggggacgctgccgcgtacctcgagcgggaag
ctgcgccggagcgaggccttgcggcgctacctcgcgggcgagctgacggcgcccaggaag
gtggggacggtggggctggtggtggagatggcgaagagtgccctggccttcgcccgctcg
ggacgcgacgagtga

DBGET integrated database retrieval system