KEGG   Akkermansia glycaniphila: PYTT_0365Help
Entry
PYTT_0365         CDS       T04551                                 

Definition
(GenBank) sialidases
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
agl  Akkermansia glycaniphila
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:agl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PYTT_0365
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PYTT_0365
Enzymes [BR:agl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     PYTT_0365
Bacterial toxins [BR:agl02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   PYTT_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(440388..442103)
Genome map
AA seq 571 aa AA seqDB search
MNVFFRIDSRFRFLSSAAVGLTLASAACADDSLPNVQVASAVEEWPAMVRMEGNGVMRLD
FSGAGNLKGGVVTVDLSPTDRPEDVESVVLRLGSKDCVYFLEKSDGGRKLAMVLGKAVSA
EKKPKARMSFTITEDVPVPEKGGVPVWVSVKMKPGADLDRRVGVRLIGVQLADRSLAVKG
GKVSRQRIGYALAQSGDTVSGAPCPQGKKSLHFRIPGMVRAQDGALVSVFDIRYDRHNDL
PSNIDVGCSRSLDGGKSWSPVRVAMNYTGAPGNPVPTGNVDFSNDYGVGDPSILLDEATG
NLWIAAIARKGIVNSKPGLTDDTTSQFVVCRSTDGGVTWEAPKSLNFQCKDAGWASFFDG
PGHGITMKARPDGVRPIVFPAQIWNRGSSSCIVYSEDQGETWKCEEQGKAQPGLPERTSE
STVVQLSDGSLMLSARHEGRSGKRVVYTTKDMGKTWQPHESNLKDLPDPTCQGSLLSVAL
PGYGKNVLLFSNPATSAPLRRNMTLKASLDDGKSWTSSLLYDSRSSCGYSDVCPIDATHA
GVLYEGLTGDQNLFFLRIPYAEIMGGGNAGK
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttttttcgtatcgattcccgttttcgttttttgtcttcagctgcagtcggc
ctgacgctggcatcggcggcttgtgccgatgattcgttgccgaatgtgcaggttgcatct
gcagtggaagaatggcccgcgatggtgcgtatggagggtaacggcgtgatgaggctggat
ttttccggtgcaggcaatttgaagggcggtgtcgtgacggtcgatttgtcgccgacggat
cggccggaggatgtggagagtgtggtgttgcgtctggggtcgaaggattgcgtgtatttt
ttggagaaaagcgacggtggcaggaagttggcgatggtgctgggcaaggcggtgagtgca
gagaagaagcccaaggcgaggatgtcgtttacgattacggaggatgtgcccgtgccggag
aagggtggggtgcccgtatgggtcagtgtgaagatgaagcccggggcggatttagaccgg
agggtgggcgtgcggctgataggtgtgcagctggcggatcgttcgcttgcggtcaagggc
ggcaaggtgtcgcggcagcgtatcggctatgcactggcccagtccggcgatactgtgagc
ggcgctccctgcccgcaagggaagaagtcgttgcatttccgtattccggggatggtgcgt
gcgcaggatggagcgttggtgtccgtgttcgatatccgttatgaccggcataacgatttg
ccgagcaatatcgatgtcggctgttcgcgttcgctggatggcggcaagtcgtggtctcca
gtgagagtggcgatgaattatacgggtgcgccgggcaatcctgtgccgacagggaatgtg
gatttttccaatgattacggggtgggcgatccttcgattctgctggatgaggcgaccggg
aatctctggatagccgctattgcgcgcaaggggatcgtcaattcgaagccggggttgacg
gacgatacgacgtcgcagttcgtggtgtgccgcagtacggatggcggtgtgacttgggag
gctccgaagagtcttaatttccagtgcaaggatgccggatgggcttcgtttttcgacggt
ccggggcatggcattacgatgaaggctcgtccggacggcgtgaggccgatcgtttttccc
gcgcagatatggaatcgcgggtcttcatcctgtatcgtgtattcggaggatcagggagag
acgtggaagtgcgaggagcaggggaaggcgcaacccggcctgcccgagcggacgagcgag
agtacggttgtgcaattgtccgacggttctctgatgctgagtgcgcgccatgaaggcagg
agcggcaagcgggtggtgtatacgacgaaggatatgggcaagacgtggcagccgcacgag
tcgaatttgaaggatttacccgaccctacttgtcagggcagcctgttgtccgtggctctg
ccgggttatggaaagaatgttttgctgttttccaatccggctacttcggcgccgctgcga
cggaatatgacgcttaaggcatccttagacgacggcaagtcgtggacgtcgtccctgttg
tacgattctcgttcttcgtgcgggtattcggatgtttgcccaatcgatgcgacgcatgca
ggcgtgctgtatgaggggctgacgggtgaccagaatctgtttttcctgcgtattccctac
gcggagattatgggcggaggcaatgccggcaagtag

DBGET integrated database retrieval system