KEGG   Anoxybacillus gonensis: AFK25_11640Help
Entry
AFK25_11640       CDS       T04000                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
agn  Anoxybacillus gonensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:agn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFK25_11640
   00030 Pentose phosphate pathway
    AFK25_11640
   00051 Fructose and mannose metabolism
    AFK25_11640
   00052 Galactose metabolism
    AFK25_11640
  Energy metabolism
   00680 Methane metabolism
    AFK25_11640
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AFK25_11640
Enzymes [BR:agn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AFK25_11640
Protein phosphatases and associated proteins [BR:agn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AFK25_11640
Messenger RNA biogenesis [BR:agn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AFK25_11640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2226096..2227055)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGLEVYGIYHGYAGLIAGNIKKLEIGDVGDI
IHRGGTMLYTARCPEFKTLEGQLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGYPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMDEIVARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIIEAL
AQKHTVDQKMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaattggtgtgcttacgagcggtggcgattcaccaggaatgaatgcggccatt
cgcgcagttgttcgaaaagcaatttaccatggattagaagtgtacggcatttaccacgga
tatgcggggttaattgccggaaacattaagaaacttgaaatcggggatgttggcgatatt
attcatcgtggtggaacgatgttatatacggcccgctgcccagaatttaaaacgttagaa
ggacagttaaaaggaattgagcaattgaaaaagcatggtattgaagggctcgttgtgatc
ggtggtgacggttcgtatcaaggggcgaaaaaattaacagaacacggctatccttgcgtc
ggcgtgccgggaacaattgataatgacattccaggaacggattttacgatcggttttgat
acagcattgaatacggttattgatgcaattgacaaaattcgtgatacagcgacatctcat
gagcgtacatacgtcattgaagtcatggggcgtcatgctggggacattgcgctttgggcc
ggtcttgctggcggagcggagagcattttaattccagaagcagattatgatatggatgaa
attgttgcgcgtctgaaacgtggacatgaacgcgggaaaaaacatagtattattattgtt
gctgaaggtgtcggtagcggtgtggaatttggtaagcgaattgaagaagcaacaggcttt
gaaacgcgtgtaactgtgttaggtcacgtccaacgtggtggttcaccgacagcgtttgac
cgtgtgcttgcaagccgtttaggtgctcgtgccgtagaattgttgcttgaaggaaaaggc
ggacgttgtgtcggcattcaaaacaatcaacttgttgatcatgacatcattgaagcgtta
gcacaaaaacatacagttgaccaaaaaatgtaccaattgtccaaagagctttcaatttaa

DBGET integrated database retrieval system