KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1304Help
Entry
AHA_1304          CDS       T00424                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AHA_1304
Enzymes [BR:aha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AHA_1304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1416240..1417601)
Genome map
AA seq 453 aa AA seqDB search
MLIAPLAHADVILHAFNWKYSEVTAKADLIKAAGYKQVLISPPLKSSGNEWWARYQPQDL
RLIDTPLGNKQDLEQLIAAMQARGIAVYADVVLNHMANESWKRSDLNYPGSELLQSYAVN
PGYFERQKLFGDLGQNLLAGQDFHPEGCISDWNDPGNVQYWRLCGSAGDKGLPDLDPNNW
VVSQQQAYLKALKGMGIKGFRVDAVKHMSDYQINAVFTPEIKQGMHVFGEVITTGGAGSN
DYERFLKPYLDSSGQGAYDFPLFASLRGALGYGGSMNQLADPGAYGQALPGSRAVTFAIT
HDIPTNDGFRYQILNPTDEKLAYAYLLGRDGGSPLVYSDHGETQAKDGLRWQDYYLRSDL
KGMIRFHNAVQGQPMQLVGSGDCFVLFKRGKQGLVGINKCDYEQEYWLDTAKFEMNWYRN
YRDVLDQSAVVNVQSQWVRVAIPARSARLWLQE
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgcgcctttggcacatgccgacgtcatactgcacgccttcaactggaaatac
agtgaagtcaccgccaaggccgatctcatcaaggccgccggctacaaacaggtgctcatc
tcgccacccctcaagtcatcgggcaacgagtggtgggcacgttaccaaccccaggacctg
cgcctcatcgacaccccgcttggcaacaagcaggatctggagcagctgatcgccgccatg
caggcgcggggcatcgccgtctatgcggacgtggtgctcaaccacatggccaacgagagc
tggaagcgcagcgatctcaactaccccggcagcgagctgctgcaaagctatgccgtcaac
cccggctacttcgagcggcagaagctgtttggcgatctgggccagaacttgctcgccggc
caggacttccacccggaagggtgcatcagcgactggaacgatccgggcaacgtgcagtac
tggcggctgtgcggcagcgcgggcgacaaggggctgccggatcttgaccccaacaactgg
gtagtgagccagcagcaggcctacctcaaggcgctcaaggggatggggatcaagggcttt
cgggtcgatgcggtcaagcacatgagtgattaccagatcaacgccgtgttcacccccgag
ataaagcaggggatgcacgtgttcggcgaggtgatcaccaccggcggcgccggcagcaac
gattacgagcgcttcctcaagccctatctcgacagcagcggtcagggcgcctatgacttc
ccgctgtttgcctccctgcgcggagcccttggctatggcggcagcatgaaccagctggca
gatccgggggcctatggccaggcgctgccgggcagccgggcggtcaccttcgccatcacc
cacgacattcctaccaacgacggctttcgctaccagatcctgaacccgaccgacgagaag
ctggcctatgcctacctgctcggccgcgacggcggctcgccgctggtctattcggatcat
ggcgagacccaggccaaggacgggctgcgctggcaggactattacctgcgcagcgacctc
aaggggatgatccgcttccacaacgcggtgcagggccaacccatgcagctggtcggcagc
ggcgactgcttcgtgctgttcaagcgtggcaagcaggggctggtcggcatcaacaagtgc
gactacgagcaggagtactggctcgataccgccaagttcgagatgaactggtatcgcaac
tatcgggacgtgctagaccaaagcgccgtggtcaatgtgcagagccagtgggtgcgggtc
gccattcccgcccgcagcgcccgcctctggctgcaggagtaa

DBGET integrated database retrieval system