KEGG   Actinoalloteichus hoggarensis: AHOG_13445Help
Entry
AHOG_13445        CDS       T04975                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase beta
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ahg00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AHOG_13445 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHOG_13445 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AHOG_13445 (gadB)
   00430 Taurine and hypotaurine metabolism
    AHOG_13445 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    AHOG_13445 (gadB)
Enzymes [BR:ahg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AHOG_13445 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3076560..3077936
Genome map
AA seq 458 aa AA seqDB search
MVLHSGRRRDPAPQGAGNPFHGLADPDPGSEITLPHLRLRDGPLPPDAALQLVRDELELD
GSARLNLATFVTTWMEPQARALMNDCVAKNMIDKDEYPQTAELERRCVNILADLWHAPEP
ADVIGCSTTGSSEACMLAGMALKRRWHGPGRPNLVMGSNVQICWEKFCEYWEVEPRLVPM
SGERFHLTAEEAVARCDENTIGVVAILGSTFDGGYEPVAEITAALDGLRRRTGLDIPVHV
DGASGAMIAPFLDPGLTWDFRLPRVASINTSGHKYGLVYPGVGWVLWRHRELLPAELVFS
VNYLGGDMPTFALNFSRPGAEVAAQYYTFARLGREGFRAVQQAARDVATRLADRIEELGP
FRLLTRGDELPVFAFTTNERAEGFTVFDVSRRLRERGWQVPAYSFPAERQDLSVLRIVCR
NGFTQDLADLFFEELRRVLAELRSAPDCGHATETAFHH
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcattcgggccgtcgccgggaccccgctccgcagggggcgggcaatccgttc
cacggcttggccgatcccgacccgggctccgagatcacgctaccccacctgcgtctgcgg
gacggccccctgccgccggacgccgcgctccaactcgtacgggacgagctggagctcgac
ggcagcgcccgactcaatctcgcgacgttcgtgaccacgtggatggaaccccaggctcgc
gcgctgatgaacgactgcgtggccaagaacatgatcgacaaggacgagtatccgcagacg
gccgagctggaacgccgctgtgtgaacatcctggccgacctgtggcacgcaccggagccc
gccgatgtcatcggctgctcgaccaccggctcctcggaggcctgcatgctcgcgggcatg
gctctcaagcgccgatggcacgggccggggcggcccaatctggtgatgggctcgaacgtc
cagatctgctgggagaagttctgtgaatactgggaggtcgaaccccgcctggtgccgatg
tcgggggagcgcttccacctcaccgctgaggaggccgtcgcgcggtgcgacgagaacacc
atcggcgtcgtcgccatcctcgggtccaccttcgacggcggttacgagcccgtcgccgag
atcaccgcggcgctggacggcctacgacgacgcaccggcctcgacatcccggtgcacgtc
gacggggcctccggcgccatgatcgctccctttctcgatccgggactgacctgggacttc
cggctgccgcgagtggcgtcgatcaacacctccggccacaagtacggcctggtctacccc
ggagtgggctgggtgttgtggcggcatcgagagctgttgcccgctgaactggtgttctcc
gtgaactatctcggcggcgacatgccgaccttcgccctcaacttctcgcggcccggcgcg
gaggtggcggcgcagtactacaccttcgcccgactgggccgggagggattccgcgcggtt
cagcaggccgcgagggacgtggccactcggctggcggaccggatcgaggagctcgggccg
ttccggctgctcacccgaggcgacgaactgccggtgttcgccttcaccacgaacgagcgt
gccgagggcttcacggtcttcgacgtctctcggcggctgcgggagcgtggttggcaggtc
cccgcctacagcttcccggcggaacgacaggacctctcggtcctgcggatcgtctgccgc
aacggcttcacgcaggatctcgccgacctgttcttcgaggagctgcgtcgggtgctcgcc
gagctgcgctccgcacccgactgcgggcacgccacggagacggccttccaccactga

DBGET integrated database retrieval system