KEGG   Actinoalloteichus hoggarensis: AHOG_22785Help
Entry
AHOG_22785        CDS       T04975                                 

Gene name
pfp
Definition
(GenBank) Pyrophosphate--fructose 6-phosphate 1-phosphotransferase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
ahg00010  Glycolysis / Gluconeogenesis
ahg00030  Pentose phosphate pathway
ahg00051  Fructose and mannose metabolism
ahg00052  Galactose metabolism
ahg00680  Methane metabolism
ahg01100  Metabolic pathways
ahg01110  Biosynthesis of secondary metabolites
ahg01120  Microbial metabolism in diverse environments
ahg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ahg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHOG_22785 (pfp)
   00030 Pentose phosphate pathway
    AHOG_22785 (pfp)
   00051 Fructose and mannose metabolism
    AHOG_22785 (pfp)
   00052 Galactose metabolism
    AHOG_22785 (pfp)
  Energy metabolism
   00680 Methane metabolism
    AHOG_22785 (pfp)
Enzymes [BR:ahg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AHOG_22785 (pfp)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     AHOG_22785 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK PhoH
Motif
Other DBs
NCBI-ProteinID: ASO22170
UniProt: A0A221W850
LinkDB All DBs
Position
complement(5362973..5363998)
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGVEVYGHEFVGFRNGWRGPIEGLTKPLGLDQVEDI
LTRGGTILGSSRTNPYKTEGGVDAIRATLADQGVDALVAIGGEDTLGVAKRLTDDGIGVV
GVPKTIDNDLNATDYTFGFDTAVHIATEAIDRLRTTAESHHRALVVEVMGRHAGWIALHS
GLAGGANVILTPEREFDIDQVVGWVERRFEREYAPIIVVAEGAVPKGGEAVLSHGEKDAF
GHVRLGGVGNWLAEEIATRTGKESRAVVLGHVQRGGTPTAYDRVLATRFGLHAIDAVHDS
DFGVMVALRGTDIVRVKLAEATAELKTVPASRYAEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggtgtgctcaccggcggcggcgactgcccgggtctgaacgcggtcatccga
gcggtggtccgcaagggcgtcgaggtctacgggcacgagttcgtcgggttccgcaacggc
tggagaggcccgatcgaggggctgaccaagccgctggggctcgaccaggtggaggacatc
ctcaccaggggcgggaccatcctgggctcctccaggaccaacccgtacaagaccgagggc
ggcgtcgacgccatccgcgcgacgctggccgaccagggcgtcgacgcgctggtcgcgatc
ggcggcgaggacaccctcggcgtggcgaagcggctcaccgacgacggcatcggcgtcgtc
ggcgtcccgaagacgatcgacaacgacctcaacgccaccgactacaccttcggcttcgac
acggcggtccacatcgccaccgaggccatcgaccggctgcggaccacggcggagtcccac
caccgcgcgctggtcgtcgaggtcatgggccgtcacgcgggatggatcgcgctgcactcc
gggctggcgggcggcgcgaacgtgatcctgaccccggagcgggagttcgacatcgaccag
gtcgtcggctgggtcgagcgccgcttcgagcgggagtacgccccgatcatcgtcgtcgcc
gagggcgcggtccccaagggcggcgaggccgtgctcagccacggtgagaaggacgccttc
ggtcacgtccgcctcggcggcgtcggcaactggctggcggaggagatcgccacccggacc
ggcaaggagtcgcgggcggtcgtcctcggccacgtccagcgcggcggcaccccgacggcc
tacgaccgggtgctggccacccgcttcggcctgcacgccatcgacgcggtgcacgactcg
gacttcggcgtgatggtcgccctgcgcggcaccgacatcgtccgcgtcaagctcgccgag
gccaccgccgagctgaagaccgtccccgcctcgcgctacgccgaggccgaggtcttcttc
ggctga

DBGET integrated database retrieval system