KEGG   Actinoalloteichus hoggarensis: AHOG_26670Help
Entry
AHOG_26670        CDS       T04975                                 

Gene name
kynU
Definition
(GenBank) Kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
ahg  Actinoalloteichus hoggarensis
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahg00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    AHOG_26670 (kynU)
Enzymes [BR:ahg01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AHOG_26670 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
6302663..6303943
Genome map
AA seq 426 aa AA seqDB search
MSDLDAAGRTGFDDAVSADSAAETAELAERARALDESDPLATVRERFSLPPGVVYLDGNS
LGALPSAVPGRVAEAISREWGQGLIASWWDAGWWDAPQRVGELIAPLLGAAPGQVVVGDS
TSVNVFRAVVAGWRLARQDDPGRTEIVVDDTTFPTDGYLAASAGRLLGARVRRAHPTDVH
AFDERTAVALMNHVDYRTGRRWDLPAVTARAQQAGARIVWDLSHSAGALPVDLDRHGVDL
AVGCGYKFLNGGPGAPSYLYVRSELHERLDQPLPGWSSHAEPFAMEPDYRPADGMARARG
GTPEILSLLALEAALGVWQGVEIDQVRVKSLALTGFFMDCVAALTAPGRFRVLTPRDDDR
GSQVSLSAPDAAELLPRLARAQVIGDHRPPDVLRFGFAPLYVGFADTLRAARILAETAGG
RAPAAG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatctcgacgctgccggtcggaccgggttcgacgatgccgtctcggccgactcc
gcggccgagacggccgagctggccgagcgggcccgtgccctggacgaatccgacccgctg
gcgacggtgcgagagcgcttctcgctgccgcccggagtcgtctatctggacggcaactcg
ctcggggccctgcccagcgcggtgccgggccgcgtcgcggaggcgatcagccgcgagtgg
ggtcagggcctcatcgcctcgtggtgggacgccggctggtgggacgcgccgcaacgggtg
ggcgagctgatcgcgcctctgctgggtgccgcgcccggccaggtcgtcgtgggcgactcg
accagtgtgaacgtgttccgcgccgtggtcgccggctggcggctggcccggcaggacgat
cccggacgtaccgagatcgtggtggacgacaccaccttcccgaccgacggctacctcgcc
gcgtcggcgggcagactcctcggcgcgcgggttcggcgagcgcacccgacggacgtccac
gccttcgacgagcgcaccgcggtcgccttgatgaaccatgtcgactaccgcaccgggcgc
cgctgggatctgcccgccgtcacggcgcgggctcagcaggccggcgctcgcatcgtgtgg
gacctgtcgcacagcgcgggcgccctgcccgtcgacctggaccggcacggcgtcgacctc
gccgtcgggtgcggttacaagttcctcaacggcggacccggggccccgtcctatctgtac
gtgcgatccgagctgcacgagcggctcgatcagccgctgcccggctggtcctcccacgcg
gagcccttcgcgatggagcccgactaccggcccgccgacggtatggctcgtgcgcgcggc
ggtacccccgagatcctgtcgctgctggccctggaagcggcgctgggtgtctggcagggc
gtcgagatcgatcaggtgcgagtcaagagcctggcgttgacgggcttcttcatggactgc
gtcgcggcgttgacggcgccgggccgcttccgagtgctgaccccgcgggacgacgaccga
ggcagccaggtctccctgagcgcgcccgacgccgccgagctgctccctcggctggcccgg
gcacaggtcatcggcgaccaccgcccgccggacgtgctccggttcggcttcgcaccgctg
tacgtcggcttcgccgacacgttgcgggcggcacggatcctggccgagacggccggagga
cgggcgcctgcggcgggctga

DBGET integrated database retrieval system