KEGG   Aeromonas hydrophila AH10: VU14_11150Help
Entry
VU14_11150        CDS       T03886                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ahi  Aeromonas hydrophila AH10
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ahi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VU14_11150
Enzymes [BR:ahi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     VU14_11150
Transporters [BR:ahi02000]
 Other Transporters
  Pores ion channels [TC:1]
   VU14_11150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2489126..2489761)
Genome map
AA seq 211 aa AA seqDB search
MITLYGTPVSRALRVSWLLEELDVAWQFQFLDFAKGENRSDWFLTLNPSGKMPVLKDGEF
VLTESAAIMQYLAEVYGPNWLPARGTQASALHAQWVSFITCELDQPLWTIGKHRFALPEA
QRLPAIFPTAKWEFDKAAAIAESWVPEQGYLLGEQVTIADLLLAHTLMWATRFEQTIPAK
LAAYRDRLAKRPALQAVLAKTQAIADAAQAG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccttatatggcacccctgtcagccgggcactgcgcgtatcctggttactggaa
gagctggacgtggcatggcagttccagtttctcgacttcgccaagggcgagaaccgcagc
gactggtttttgaccctcaacccgagcggcaagatgccggtgctcaaggacggggagttc
gtgctgaccgaatccgccgccatcatgcagtacctggccgaggtgtatggcccgaactgg
ctgccagccagagggacccaggcctcggcgctgcacgcccagtgggtcagtttcatcacc
tgcgagctggaccagccgctgtggacaatcggcaagcaccgcttcgccctgcccgaggcc
cagcgtctgccggccatcttccccaccgccaagtgggagttcgacaaggcggcggccatc
gccgaatcctgggtacccgagcagggttacctgctgggtgagcaggtaaccatcgccgat
ctactgctggcccataccctgatgtgggccacccgcttcgagcagaccattccagccaag
ctggcggcctatcgggatcgtctggccaaacgccccgccctgcaggcggtgctggccaag
acccaggccatcgccgatgccgcccaggccggctga

DBGET integrated database retrieval system