KEGG   Aeromonas hydrophila J-1: V469_18860Help
Entry
V469_18860        CDS       T03574                                 

Definition
(GenBank) alpha-amlyase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ahj  Aeromonas hydrophila J-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    V469_18860
Enzymes [BR:ahj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     V469_18860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4124539..4127115
Genome map
AA seq 858 aa AA seqDB search
MHSTLLRTALLTAALGSFSHTATAEGVMVHLFQWKFNDIANECETVLGPKGFGGVQITPP
AEHKQGSQVWWTVYQPVSFKNFNSFGGSEAELRSMIARCNAAGVKVYADAVFNQLASGSG
TATGGGSYNAGQYQYPQFGYNDFHHSGDITNYGDSNNVWNGALYGMPDLNTGSPYVQDQI
ATYMKTLLGWGVAGFRIDAAKHMAPTDVKAILDKAGSPRAYLEVIGAGGESADIQPGRYT
YIDTVTDFKYGTDLAANFNGQIKNLKTLGESWGLLPSAKAFVFVVNHDRERGHGGGGMLT
FMSGARYDLANTFMMAWPYGWKQVMSGYRFENMSTYETDKGAPGSTPCTDSQWNCEQRRP
TIMNMALFHNRTEGQPVSNWWDNGNNQIAFGRGDKGFVAINNESGSLVASLQTALPAGEY
CNLLGGNDYCSGGYVTVDGSGKASLNVPGMKAAAIIAGCTKASPCGGSALPGNKFSSMNL
RGTHNAWGNTPMTVDANRVWSATLTLTGNGDATGAQRFKFDVFGNWAENYGDNEGDGIAD
KGSSKDIQVSGAGSYRITLNESDLRYTVTPLTSNQAPVAALSPKTLSVKAGESVVFDASA
SRDDGGVVSYSWSSGGTAATETVRFDTPGTHVVTVTVTDAEGLTASASATVTVTDDNGTY
ASVLPTLNFRGTPNAWGSLAMTLVADNQWEALVTFDGQANQRFKFDVKGDWSKNYGDTNK
DGVAELAGSDILTSVTGQYRVRFNDQTLQYSLSPVSVGYAKNFASLNIRGTTNNWGSTPM
SLVGDHLWQASVTFTGSGDGNGGQRFKFDVKGDWTQNYGDTNKDGVAEPAGTDITTAVVG
VYVVRFNDQTLAYSLNAQ
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgcacagcacactgcttcgaaccgccctgctgacggcggcactcggctctttcagccac
actgccaccgccgaaggggtcatggttcacctgttccaatggaagttcaacgacatcgcc
aacgagtgcgaaaccgtgctcgggcccaaggggttcgggggcgtccagatcaccccaccg
gccgagcacaagcagggcagccaggtctggtggaccgtctatcaacccgtcagcttcaag
aatttcaacagcttcggcggtagcgaggcggaactcagaagcatgatcgcccgctgcaac
gcagccggggtcaaggtctatgccgacgccgtcttcaaccagctggcatcgggctccggc
accgccaccggtggcggcagctacaacgcggggcagtaccagtatccccagttcggctac
aacgacttccaccacagcggcgacatcaccaactacggtgacagcaacaacgtctggaac
ggcgccctctacggcatgccggacctcaataccggctctccctacgtgcaggatcagatc
gccacctacatgaagaccctgctcggctggggcgtggcgggctttcgtatcgatgcggct
aagcacatggccccgaccgatgtgaaggccatcctcgacaaggcgggcagccccagggcc
tacctggaggtgatcggcgcaggcggggagtccgccgacatccagccgggccgctacacc
tatatcgacaccgtcaccgacttcaaatacggcaccgatctcgccgccaacttcaacggc
cagatcaagaacctcaagaccctgggcgagagctggggcctgctcccctccgctaaggcc
ttcgtcttcgtggtgaaccacgaccgcgaacgcggccacggtgggggcggcatgctcacc
ttcatgagcggtgctcgctacgatctggccaacaccttcatgatggcctggccctatggc
tggaagcaggtcatgtcgggctatcgcttcgaaaatatgagcacctatgaaaccgacaag
ggggcaccgggcagcacaccctgcacggacagccagtggaactgcgaacaacgccggccg
accatcatgaacatggccctgttccacaaccggaccgaaggccagccggtcagcaactgg
tgggacaacggcaacaaccagatcgccttcggccgcggtgacaagggcttcgtcgccatc
aacaacgaaagcggcagcctggtggcctcgctgcagaccgcgctgccggccggcgagtac
tgcaacctcttgggcggcaatgactactgcagcggcggctatgtcaccgtcgacggcagt
ggcaaggccagcctgaacgtgcccggcatgaaggcggccgccatcatcgccggttgcacc
aaagccagcccctgcggcggttccgccctgccgggcaacaagttcagcagcatgaacctg
cgcggtacccacaacgcctggggcaatacccccatgaccgtcgatgccaaccgtgtctgg
tcagccaccctcaccctgaccggcaacggtgatgcaaccggcgcccagcgcttcaagttc
gacgtcttcggcaactgggccgaaaactacggcgacaacgaaggggatggcatcgccgac
aagggcagcagcaaggacattcaggtcagcggggcgggcagctaccgcatcaccctgaac
gaaagcgatctgcgttacacggtcacccccctcaccagcaaccaggcgccggtggccgcc
ctctcccccaagaccctcagcgtcaaggcgggtgagagcgtggtgttcgatgcctccgcc
tcccgcgacgacgggggcgtggtgagctacagctggtccagcggtggcaccgccgccacc
gagacggtccggttcgataccccgggcacccatgtcgtgacggtcaccgtgaccgatgca
gaaggcttgaccgccagtgccagcgctaccgtgaccgtcaccgacgacaacggcacctac
gccagcgtgctgcccaccctgaatttccgcggtactcccaatgcctggggatcccttgcc
atgacgctggtcgccgacaaccagtgggaggctctggtcaccttcgatggtcaggcaaac
cagcgcttcaagttcgacgtcaagggggactggagcaagaactatggtgacaccaacaag
gatggagtggccgaactggccggcagtgacatcctgacctcggtcaccggccagtatcgg
gtgcgcttcaacgatcagaccctgcaatacagcctgagcccagtcagcgtcggctacgcg
aagaacttcgccagcctcaacattcgcggcaccaccaacaactggggctccacccccatg
tcgctggtaggcgatcacctctggcaggccagcgtcaccttcaccggtagcggcgatggc
aacggcggtcagcgcttcaagttcgacgtcaagggcgactggacccagaactacggcgac
accaacaaggacggtgtcgccgagccggccggcaccgacatcaccacggctgtagtcggt
gtctatgtggtgcgcttcaacgaccagacgctggcctatagtctgaacgcccagtaa

DBGET integrated database retrieval system