KEGG   Actinoalloteichus hymeniacidonis: TL08_10725Help
Entry
TL08_10725        CDS       T04472                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ahm  Actinoalloteichus hymeniacidonis
Brite
Enzymes [BR:ahm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TL08_10725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AOS62959
UniProt: A0A1D8BW07
LinkDB All DBs
Position
complement(2319062..2319670)
Genome map
AA seq 202 aa AA seqDB search
MTYTLPDLPYDYGALEPHISGKIMELHHSKHHATYVKGANDALEQAAESREKNQLGTVNL
LQKNLAFNLAGHVNHSVFWPNLSPNGGDKPDGELGAAIDDAFGSFDGFRAHFTANALGIQ
GSGWSILAWDSLGQRLLLEQLYDHQGNLAAGSYPLLMLDMWEHAFYLQYQNVKADYVKAF
WNIVNWADVTERFEKARGVKIN
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtacacccttccggacctgccctacgattacggcgcactcgaaccgcacatctcc
ggcaagatcatggagctgcaccacagcaagcaccacgcgacctacgtcaagggcgcgaac
gacgcgctggagcaggcggcggagtcccgggagaagaaccagctcggcaccgtcaacctg
ttgcagaagaacctcgcgttcaacctcgcgggtcacgtgaaccactccgtcttctggccg
aacctgtcgcccaacggcggcgacaagccggacggcgagctgggcgcggcgatcgacgat
gccttcggttccttcgacggcttccgggcgcacttcaccgcgaacgcactgggcatccag
ggctccggttggtccatcctggcctgggactccctcggccagcggctgctgctagagcag
ctctacgaccaccagggcaacctggcggcaggcagctacccgctgctcatgctggacatg
tgggagcacgccttctacctccagtaccagaacgtcaaggccgactacgtcaaggcgttc
tggaacatcgtgaactgggcggacgtgaccgagcgcttcgagaaggctcggggcgtgaag
atcaactga

DBGET integrated database retrieval system