KEGG   Actinoalloteichus hymeniacidonis: TL08_21655Help
Entry
TL08_21655        CDS       T04472                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ahm  Actinoalloteichus hymeniacidonis
Pathway
ahm00010  Glycolysis / Gluconeogenesis
ahm00030  Pentose phosphate pathway
ahm00051  Fructose and mannose metabolism
ahm00052  Galactose metabolism
ahm00680  Methane metabolism
ahm01100  Metabolic pathways
ahm01110  Biosynthesis of secondary metabolites
ahm01120  Microbial metabolism in diverse environments
ahm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ahm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TL08_21655
   00030 Pentose phosphate pathway
    TL08_21655
   00051 Fructose and mannose metabolism
    TL08_21655
   00052 Galactose metabolism
    TL08_21655
  Energy metabolism
   00680 Methane metabolism
    TL08_21655
Enzymes [BR:ahm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TL08_21655
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     TL08_21655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_6 Fe-ADH PhoH DUF128
Motif
Other DBs
NCBI-ProteinID: AOS65118
UniProt: A0A1D8C241
LinkDB All DBs
Position
complement(5099232..5100257)
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAAVRKGVEVYGHEFVGFRNGWRGPIEGLTKPLGLDDVEDI
LTRGGTILGSSRTNPYKTEGGVEAIRSTLKDQGVDALIAIGGEDTLGVAKRLTDDGIGVV
GVPKTIDNDLNATDYTFGFDTAVHIATEAIDRLRTTAESHHRALVVEVMGRHAGWIALHS
GLAGGANVILTPENEFDIDQVVGWVERRFEREYAPIIVVAEGAVPKGGDAVLSHGEKDAF
GHVRLGGIGTWLAEEIATRTGKESRAVVLGHVQRGGTPTAYDRVLATRFGLHAIDAVHDS
DFGVMVALRGTDIVRVKLAEATAELKTVPASRYAEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggtgtgctcaccggcggcggcgactgtccgggtctgaacgcggtcatccgt
gcggcggtccgcaagggcgtcgaggtctacgggcacgaattcgtcgggttccgcaacggc
tggcgaggcccgatcgaggggctgaccaagccgctcgggctcgacgacgtcgaggacatc
ctcaccagaggcgggacgatcctcggatcctccaggaccaacccgtacaagaccgagggc
ggcgtggaggcgatccgctcgacgctgaaggatcagggcgtcgacgcgctgatcgccatc
ggcggcgaggacaccctcggcgtggcgaagcggctgaccgacgacggcatcggcgtcgtg
ggcgtgcccaagacgatcgacaacgacctcaacgccaccgactacaccttcggcttcgac
accgcggtgcacatcgccaccgaggcgatcgaccggctgcggaccaccgccgagtcgcac
caccgcgcgctcgtcgtggaggtcatgggtcggcacgcgggctggatcgcgctgcactcc
ggcctcgcgggcggtgcgaacgtgatcctgacgccggagaacgagttcgacatcgaccag
gtcgtcggctgggtcgagcgtcgtttcgagcgcgagtacgcgccgatcatcgtggtcgcc
gagggcgcggtgcccaagggcggcgacgcggtgctcagccacggggagaaggacgcgttc
ggtcacgtccgcctcggtggcatcggcacctggttggccgaggagatcgccaccaggacc
ggcaaggagtccagggccgtggtgctcggacacgtccagcgcggcggcaccccgaccgcc
tacgaccgggtgctggccacccgcttcggcctgcacgccatcgacgcggtgcacgactcg
gacttcggtgtgatggtcgcgctgcgcggcaccgacatcgtccgcgtcaagctcgccgag
gccaccgccgaactcaagaccgtccccgcctcgcgctacgccgaggccgaggtcttcttc
ggctga

DBGET integrated database retrieval system