KEGG   Azospirillum humicireducens: A6A40_13150Help
Entry
A6A40_13150       CDS       T04409                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ahu  Azospirillum humicireducens
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ahu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6A40_13150
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    A6A40_13150
   00680 Methane metabolism
    A6A40_13150
Enzymes [BR:ahu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A6A40_13150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2810645..2813416)
Genome map
AA seq 923 aa AA seqDB search
MSAILLQESSETKDQPLREDIRLLGRILGDTVRSQEGEAVFDIVERIRQTSIRFHREEDQ
GARKELEAILNSLSPPQTARVVRAYSFFSHLANIAEDQHHIRRTRAHALAGSSPRDGTMA
HALDEAAKAGVTTQQLKEFFDGALVSPVLTAHPTEVQRKSILTVQMEVAKLLAERDHGPM
TPEEEETNLESLQRAVLTLWQTAILRATKLAVTDEVANGLTFYDYTFLREMPRFYAQLED
HLRRTDPSWTTTELPSFLRMGSWIGGDRDGNPFVTAPVLRQAMRMQSTRALQFYLDELHT
LGSELSLSTRVIDVSEPLRQLAERSPDPSPHRKMEPYRRAISGIYARVAATLRTLDGLEA
PRHAVGEAPPYLAPAELRADLDIIDRSLTVNGSAALAKGRLRHLRRAVDLFGFHLASIDL
RQNSDVHERSVAELLSFADTAVDYKTLSEDERIDLLVRELETNRPLASRYADYSEETSSE
LDILRTAADARARFGSDAVVNCVISKTDGVSDILEVAVLLKEAGLLRPKDKALDLNIAPL
FETIGDLRNCAATMDRLLSIPTYRRFLESRGNLQEVMLGYSDSNKDGGFLTSGWELYKAE
IALVEVFAKHGVRLRLFHGRGGSVGRGGGPSYQAILAQPAGAVQGAIRITEQGEVIAGKY
SNPEVGRRNLETLAAATLEATLLHPESAEPCTDLFLQTMEELSEHAFKAYRGLVYETEGF
EKYFWESTVIGEIANLNIGSRPASRKKSTSIEDLRAIPWVFSWAQCRLMLPGWYGFGSAV
KAYLAQHPDGMERLRAMHRDWGFFRTLLSNMDMVLSKSNIAIASRYAGLVSDPDLREAIF
SRIRAEWQDSIEVLLAITEQSALLEKNPLLARSIRNRFPYLDPLNHVQVELLKRHRTSDS
GEQIARGIHLTINGIAAGLRNSG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccatcctgctgcaggaaagttccgagacgaaggaccagccgctccgcgaagac
atccgcctgctggggcgcatcctgggcgataccgtccgcagccaggaaggggaggcggtg
ttcgacatcgtcgagcgcatccgccagacctccatccggttccaccgcgaagaggaccag
ggcgcccgcaaggagcttgaggcgatcctgaacagcctgtcgccgccgcagacggcgcgg
gtggtgcgggcctacagcttcttctcgcatctggccaacatcgccgaggatcagcaccac
atccgccgcacccgcgcccatgcgctcgccggatcgtcgccgcgcgacggcaccatggcc
catgcgctggacgaggcggccaaggccggcgtcaccacccagcagctgaaggagttcttc
gacggcgcgctggtcagcccggtgctgaccgcccacccgaccgaggtgcagcgcaagagc
atcctgaccgtgcagatggaggtcgccaagctgctggcggagcgcgaccacggcccgatg
acgccggaggaggaggaaaccaaccttgaatccctccagcgcgcggtgctgacgctgtgg
cagaccgccatcctgcgcgccaccaagctggcggtgacggacgaggtggccaacggcctg
accttctacgactacaccttcctgcgcgagatgccgcgcttctatgcccagttggaagac
catctgcggcggacggatccgtcctggacgacaacggagctgccgtccttcctgcgcatg
ggcagctggatcggcggcgaccgcgacggcaaccccttcgtcaccgcccccgtcctgcgt
caggcgatgcggatgcagagcacccgcgccctgcaattctacctggacgaactgcacacg
ctggggtctgagctgtcgctcagcacccgtgtcatcgacgtttcggagccgctgcgccag
ctggccgaacgctcgcccgacccgtcgccccaccgcaagatggagccgtaccgccgcgcc
atctccggcatctatgcgcgggtcgccgcgacgctgcggacgctggacgggctggaggcg
ccccgccacgccgtgggcgaggcgccgccctatctggccccggccgagctccgcgccgac
ctcgacatcatcgaccgctcgctgaccgtcaacggctcggcggcgctcgccaagggccgg
ctgcgccacctgcgccgggccgtcgacctgttcggcttccatctggccagcatcgacctg
cgccagaactccgacgtgcatgagcggtcggtggcggagctgctgtccttcgccgacacc
gccgtcgactacaagacactgtcggaggacgagcggatcgacctgctggtgcgcgagctg
gagaccaaccggccgctggcctcgcgctatgccgactattcggaggaaaccagctccgaa
ctggacatcctgcgcaccgccgccgatgcccgcgcccgcttcgggtcggatgcggtggtg
aactgcgtcatctccaagaccgacggcgtgtcggacatcctggaggtcgccgtcctgctg
aaggaggccgggctgctgcggccgaaggacaaggcgctggacctgaacatcgccccgctg
ttcgagaccatcggcgatctgcgcaactgcgccgccaccatggaccggctgctgtcgatc
cccacttaccggcgcttcctggaaagccggggcaacctgcaggaggtgatgctcggctat
tctgacagcaacaaggacggcggcttcctcacctccggctgggagctgtacaaggccgag
atcgcgctggtcgaggtgttcgccaagcatggcgtgcggctgcggctgttccatggccgc
ggcggctcggtcggccgcggcggcggccccagctatcaggcgatcctggcccagccggcc
ggtgcggtgcagggcgccatccgcatcaccgagcagggcgaggtcatcgccgggaaatat
tccaaccccgaggtcggccggcgcaacctggaaacgctggcggcggcgacgctggaagcg
accctgctgcacccggaatcggcggaaccctgcaccgatctgttcctccagaccatggaa
gagctgtcggagcatgccttcaaggcctatcgcgggctggtctacgagaccgaaggcttc
gagaagtatttctgggaatcgacggtgatcggcgagatcgccaacctcaacatcggcagc
cgcccggcctcgcgcaagaaatcgaccagcatcgaggatctgcgggcaattccctgggtg
ttcagctgggcgcagtgccgcctgatgctgccgggctggtacggcttcggctcggcggtg
aaggcctatctggcccagcaccccgacgggatggagcggctgcgggcgatgcaccgcgac
tggggcttcttccgcacgctgctgtccaacatggacatggtgctgtccaagtcgaacatc
gccatcgcatcccgctatgccgggctggtgtcggacccggatcttcgggaggccatcttc
tcccgcatccgggcggagtggcaggactccatcgaggttctgctggcgatcaccgagcag
tcggccctcttggagaagaacccgctgctcgcgcggtcgatccgcaaccgcttcccctat
ctggacccgctcaaccatgtccaggtcgagctgctgaagcgccaccgcaccagcgacagc
ggcgagcagatcgcccgcggcatccatctgaccatcaacggcatcgccgccggcctgcgc
aacagcggctga

DBGET integrated database retrieval system