KEGG   Arachis ipaensis: 107612911Help
Entry
107612911         CDS       T04301                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
aip  Arachis ipaensis
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aip00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    107612911
Enzymes [BR:aip01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     107612911
Transporters [BR:aip02000]
 Other Transporters
  Pores ion channels [TC:1]
   107612911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
B08
AA seq 219 aa AA seqDB search
MADEVTLLDFWPSPFGMRLRIALAEKGIKYEYKDEDLRNKSPLLLKMNPVHKKIPVLIHN
GKPICESLIAVQYIDEVWSDRSPLLPSDPYQRAQARFWADFVDKKIYDAGRKVWTLKGEE
QEAGKKEFLDALKLLEDQLGDKPYFGGDNIGYVDVSLVPFYSWFKAYETFGNINIEKECP
KFIAWAKRCLQKESVSSSLPDQNKVYGFIVEMRKKFGLE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgaggtgactctactggatttctggccaagcccttttgggatgaggttaaga
atagcacttgctgaaaagggtatcaagtatgagtacaaagatgaggacttgaggaacaag
agccctctgttgctgaaaatgaaccctgttcataagaaaatcccagttcttattcacaat
ggaaaacccatttgtgagtctctaattgctgttcaatacattgatgaagtgtggagtgat
agatctcctttgttgccttctgatccttatcaaagagctcaggctaggttctgggctgat
tttgtcgacaagaagatttatgatgctggaaggaaggtatggaccctgaaaggagaagaa
caagaagctgggaagaaagagttcttggatgcccttaaactcttggaggatcaacttggt
gacaagccctattttggaggtgacaacattggttatgttgatgtgtcacttgttccattc
tacagctggttcaaggcatatgagacatttggcaacatcaacatagaaaaagagtgtccc
aaattcattgcttgggccaagaggtgtcttcagaaggaaagtgtctctagttcactccct
gaccaaaacaaagtctatggtttcattgttgagatgagaaagaagtttggtttagagtga

DBGET integrated database retrieval system